Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CYTH3Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CYTH3 Polyclonal Antibody | anti-CYTH3 antibody

CYTH3 Antibody - N-terminal region

Gene Names
CYTH3; GRP1; ARNO3; PSCD3; cytohesin-3
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CYTH3; Polyclonal Antibody; CYTH3 Antibody - N-terminal region; anti-CYTH3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NLTSVEESKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQ
Sequence Length
400
Applicable Applications for anti-CYTH3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CYTH3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CYTH3Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CYTH3Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CYTH3 antibody
Promotes guanine-nucleotide exchange on ARF1 and ARF6. Promotes the activation of ARF factors through replacement of GDP with GTP. Play a role in the epithelial polarization (By similarity).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46 kDa
NCBI Official Full Name
cytohesin-3 isoform a
NCBI Official Synonym Full Names
cytohesin 3
NCBI Official Symbol
CYTH3
NCBI Official Synonym Symbols
GRP1; ARNO3; PSCD3; cytohesin-3
NCBI Protein Information
cytohesin-3
UniProt Protein Name
Cytohesin-3
Protein Family
UniProt Gene Name
CYTH3
UniProt Synonym Gene Names
ARNO3; GRP1; PSCD3; Protein ARNO3; Grp1
UniProt Entry Name
CYH3_HUMAN

NCBI Description

This gene encodes a member of the PSCD (pleckstrin homology, Sec7 and coiled-coil domains) family. PSCD family members have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. This encoded protein is involved in the control of Golgi structure and function, and it may have a physiological role in regulating ADP-ribosylation factor protein 6 (ARF) functions, in addition to acting on ARF1. [provided by RefSeq, Jul 2008]

Uniprot Description

cytohesin 3: Promotes guanine-nucleotide exchange on ARF1. Promotes the activation of ARF through replacement of GDP with GTP. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; GEFs; GEFs, ARF; Lipid-binding; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 7p22.1

Cellular Component: ruffle; extrinsic to internal side of plasma membrane; plasma membrane; trans-Golgi network; cytosol

Molecular Function: phosphatidylinositol-3,4,5-triphosphate binding; ARF guanyl-nucleotide exchange factor activity

Biological Process: regulation of cell adhesion; vesicle-mediated transport; positive regulation of cell adhesion; regulation of ARF protein signal transduction; positive regulation of GTPase activity; Golgi vesicle transport

Research Articles on CYTH3

Similar Products

Product Notes

The CYTH3 cyth3 (Catalog #AAA3224114) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYTH3 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYTH3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CYTH3 cyth3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NLTSVEESKT TQRNKQIAMG RKKFNMDPKK GIQFLIENDL LQSSPEDVAQ. It is sometimes possible for the material contained within the vial of "CYTH3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.