Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CYTH2Sample Tissue: Human MDA-MB-435S Whole CellAntibody Dilution: 1ug/ml)

Rabbit CYTH2 Polyclonal Antibody | anti-CYTH2 antibody

CYTH2 Antibody - C-terminal region

Gene Names
CYTH2; ARNO; CTS18; PSCD2; SEC7L; PSCD2L; CTS18.1; Sec7p-L; Sec7p-like; cytohesin-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CYTH2; Polyclonal Antibody; CYTH2 Antibody - C-terminal region; anti-CYTH2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPN
Sequence Length
400
Applicable Applications for anti-CYTH2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CYTH2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CYTH2Sample Tissue: Human MDA-MB-435S Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CYTH2Sample Tissue: Human MDA-MB-435S Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-CYTH2 antibody
This is a rabbit polyclonal antibody against CYTH2. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The encoded protein exhibits GEP activity in vitro with ARF1, ARF3, and ARF6 and is 83% homologous to CYTH1. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-CYTH2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
cytohesin-2 isoform 1
NCBI Official Synonym Full Names
cytohesin 2
NCBI Official Symbol
CYTH2
NCBI Official Synonym Symbols
ARNO; CTS18; PSCD2; SEC7L; PSCD2L; CTS18.1; Sec7p-L; Sec7p-like; cytohesin-2
NCBI Protein Information
cytohesin-2
UniProt Protein Name
Cytohesin-2
Protein Family
UniProt Gene Name
CYTH2
UniProt Synonym Gene Names
ARNO; PSCD2; PSCD2L; Protein ARNO
UniProt Entry Name
CYH2_HUMAN

NCBI Description

The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The encoded protein exhibits GEP activity in vitro with ARF1, ARF3, and ARF6 and is 83% homologous to CYTH1. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]

Uniprot Description

cytohesin 2: Acts as a guanine-nucleotide exchange factor (GEF). Promotes guanine-nucleotide exchange on ARF1, ARF3 and ARF6. Promotes the activation of ARF factors through replacement of GDP with GTP. The cell membrane form, in association with ARL4 proteins, recruits ARF6 to the plasma membrane. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GEFs; GEFs, ARF

Chromosomal Location of Human Ortholog: 19q13.33

Cellular Component: membrane; cytoplasm; plasma membrane; trans-Golgi network

Molecular Function: protein binding; lipid binding; ARF guanyl-nucleotide exchange factor activity

Biological Process: regulation of cell adhesion; vesicle-mediated transport; endocytosis; regulation of ARF protein signal transduction; actin cytoskeleton organization and biogenesis; positive regulation of GTPase activity

Research Articles on CYTH2

Similar Products

Product Notes

The CYTH2 cyth2 (Catalog #AAA3218374) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYTH2 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CYTH2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CYTH2 cyth2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GRVKTWKRRW FILTDNCLYY FEYTTDKEPR GIIPLENLSI REVDDPRKPN. It is sometimes possible for the material contained within the vial of "CYTH2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.