Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CYR61Sample Type: COLO205 Whole Cell lysatesAntibody Dilution: 3.0ug/ml)

Rabbit CYR61 Polyclonal Antibody | anti-CYR61 antibody

CYR61 Antibody - middle region

Gene Names
CCN1; GIG1; CYR61; IGFBP10
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Synonyms
CYR61; Polyclonal Antibody; CYR61 Antibody - middle region; anti-CYR61 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CEYNSRIYQNGESFQPNCKHQCTCIDGAVGCIPLCPQELSLPNLGCPNPR
Sequence Length
381
Applicable Applications for anti-CYR61 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human CYR61
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CYR61Sample Type: COLO205 Whole Cell lysatesAntibody Dilution: 3.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CYR61Sample Type: COLO205 Whole Cell lysatesAntibody Dilution: 3.0ug/ml)
Related Product Information for anti-CYR61 antibody
This is a rabbit polyclonal antibody against CYR61. It was validated on Western Blot

Target Description: The secreted protein encoded by this gene is growth factor-inducible and promotes the adhesion of endothelial cells. The encoded protein interacts with several integrins and with heparan sulfate proteoglycan. This protein also plays a role in cell proliferation, differentiation, angiogenesis, apoptosis, and extracellular matrix formation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
protein CYR61
NCBI Official Synonym Full Names
cellular communication network factor 1
NCBI Official Symbol
CCN1
NCBI Official Synonym Symbols
GIG1; CYR61; IGFBP10
NCBI Protein Information
protein CYR61
UniProt Protein Name
CYR61 protein
Protein Family
UniProt Gene Name
CYR61
UniProt Entry Name
Q6FI18_HUMAN

NCBI Description

The secreted protein encoded by this gene is growth factor-inducible and promotes the adhesion of endothelial cells. The encoded protein interacts with several integrins and with heparan sulfate proteoglycan. This protein also plays a role in cell proliferation, differentiation, angiogenesis, apoptosis, and extracellular matrix formation. [provided by RefSeq, Sep 2011]

Uniprot Description

CYR61: Promotes cell proliferation, chemotaxis, angiogenesis and cell adhesion. Appears to play a role in wound healing by up- regulating, in skin fibroblasts, the expression of a number of genes involved in angiogenesis, inflammation and matrix remodeling including VEGA-A, VEGA-C, MMP1, MMP3, TIMP1, uPA, PAI-1 and integrins alpha-3 and alpha-5. CYR61-mediated gene regulation is dependent on heparin-binding. Down-regulates the expression of alpha-1 and alpha-2 subunits of collagen type-1. Promotes cell adhesion and adhesive signaling through integrin alpha-6/beta-1, cell migration through integrin alpha-v/beta-5 and cell proliferation through integrin alpha-v/beta-3. Belongs to the CCN family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 1p22.3

Cellular Component: extracellular matrix; proteinaceous extracellular matrix

Molecular Function: integrin binding; heparin binding; insulin-like growth factor binding; extracellular matrix binding

Biological Process: extracellular matrix organization and biogenesis; anatomical structure morphogenesis; positive regulation of caspase activity; chemotaxis; intussusceptive angiogenesis; osteoblast differentiation; cell proliferation; positive regulation of osteoblast differentiation; cell-cell signaling; positive regulation of protein kinase activity; positive regulation of osteoblast proliferation; positive regulation of transcription from RNA polymerase II promoter; regulation of cell growth; positive regulation of protein amino acid phosphorylation; cell adhesion; positive regulation of BMP signaling pathway; positive regulation of cell migration; negative regulation of apoptosis

Research Articles on CYR61

Similar Products

Product Notes

The CYR61 cyr61 (Catalog #AAA3200249) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYR61 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CYR61 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CYR61 cyr61 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CEYNSRIYQN GESFQPNCKH QCTCIDGAVG CIPLCPQELS LPNLGCPNPR. It is sometimes possible for the material contained within the vial of "CYR61, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.