Rabbit anti-Human CYP8B1 Polyclonal Antibody | anti-CYP8B1 antibody

CYP8B1 antibody - middle region

Cat. Num. AAA3214675

• Gene Names: CYP8B1; CP8B; CYP12
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: CYP8B1; Polyclonal Antibody; CYP8B1 antibody - middle region; anti-CYP8B1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: SLLWPREWLEVGRLQRLFHKMLSVSHSQEKEGISNWLGNMLQFLREQGVP
• Sequence Length: 501

• Applicable Applications for anti-CYP8B1 antibody: Western Blot (WB)
• Homology: Human: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP8B1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CYP8B1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Related Product Information for anti-CYP8B1 antibody

This is a rabbit polyclonal antibody against CYP8B1. It was validated on Western Blot

Target Description: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the conversion of 7 alpha-hydroxy-4-cholesten-3-one into 7-alpha,12-alpha-dihydroxy-4-cholesten-3-one. The balance between these two steroids determines the relative amounts of cholic acid and chenodeoxycholic acid both of which are secreted in the bile and affect the solubility of cholesterol. This gene is unique among the cytochrome P450 genes in that it is intronless.

Product Categories/Family for anti-CYP8B1 antibody

Polyclonal; Cell Adhesion; Membrane Protein; Drugs and Drug Metabolism

NCBI and Uniprot Product Information

• NCBI GI #: 166362724
• NCBI GeneID: 1582
• NCBI Accession #: NP_004382
• NCBI GenBank Nucleotide #: NM_004391
• UniProt Accession #: Q9UNU6
• Molecular Weight: 58kDa
• NCBI Official Full Name: 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase
• NCBI Official Synonym Full Names: cytochrome P450 family 8 subfamily B member 1
• NCBI Official Symbol: CYP8B1
• NCBI Official Synonym Symbols: CP8B; CYP12
• NCBI Protein Information: 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase
• UniProt Protein Name: 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase
• Protein Family: 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase
• UniProt Gene Name: CYP8B1
• UniProt Synonym Gene Names: CYP12
• UniProt Entry Name: CP8B1_HUMAN

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the conversion of 7 alpha-hydroxy-4-cholesten-3-one into 7-alpha,12-alpha-dihydroxy-4-cholesten-3-one. The balance between these two steroids determines the relative amounts of cholic acid and chenodeoxycholic acid both of which are secreted in the bile and affect the solubility of cholesterol. This gene is unique among the cytochrome P450 genes in that it is intronless. [provided by RefSeq, Jul 2008]

Uniprot Description

CYP8B1: Involved in bile acid synthesis and is responsible for the conversion of 7 alpha-hydroxy-4-cholesten-3-one into 7 alpha, 12 alpha-dihydroxy-4-cholesten-3-one. Responsible for the balance between formation of cholic acid and chenodeoxycholic acid. Has a rather broad substrate specificity including a number of 7-alpha- hydroxylated C27 steroids. Belongs to the cytochrome P450 family.

Protein type: Membrane protein, integral; Oxidoreductase; EC 1.14.13.95; Lipid Metabolism - primary bile acid biosynthesis

Chromosomal Location of Human Ortholog: 3p22.1

Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane

Molecular Function: sterol 12-alpha-hydroxylase activity; iron ion binding; 7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase activity; heme binding; oxygen binding

Biological Process: bile acid biosynthetic process; bile acid metabolic process; xenobiotic metabolic process; lipid metabolic process; sterol metabolic process