Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit anti-Human CYP8B1 Polyclonal Antibody | anti-CYP8B1 antibody

CYP8B1 antibody - middle region

Gene Names
CYP8B1; CP8B; CYP12
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CYP8B1; Polyclonal Antibody; CYP8B1 antibody - middle region; anti-CYP8B1 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLLWPREWLEVGRLQRLFHKMLSVSHSQEKEGISNWLGNMLQFLREQGVP
Sequence Length
501
Applicable Applications for anti-CYP8B1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CYP8B1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CYP8B1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Related Product Information for anti-CYP8B1 antibody
This is a rabbit polyclonal antibody against CYP8B1. It was validated on Western Blot

Target Description: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the conversion of 7 alpha-hydroxy-4-cholesten-3-one into 7-alpha,12-alpha-dihydroxy-4-cholesten-3-one. The balance between these two steroids determines the relative amounts of cholic acid and chenodeoxycholic acid both of which are secreted in the bile and affect the solubility of cholesterol. This gene is unique among the cytochrome P450 genes in that it is intronless.
Product Categories/Family for anti-CYP8B1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase
NCBI Official Synonym Full Names
cytochrome P450 family 8 subfamily B member 1
NCBI Official Symbol
CYP8B1
NCBI Official Synonym Symbols
CP8B; CYP12
NCBI Protein Information
7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase
UniProt Protein Name
7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase
UniProt Gene Name
CYP8B1
UniProt Synonym Gene Names
CYP12
UniProt Entry Name
CP8B1_HUMAN

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the conversion of 7 alpha-hydroxy-4-cholesten-3-one into 7-alpha,12-alpha-dihydroxy-4-cholesten-3-one. The balance between these two steroids determines the relative amounts of cholic acid and chenodeoxycholic acid both of which are secreted in the bile and affect the solubility of cholesterol. This gene is unique among the cytochrome P450 genes in that it is intronless. [provided by RefSeq, Jul 2008]

Uniprot Description

CYP8B1: Involved in bile acid synthesis and is responsible for the conversion of 7 alpha-hydroxy-4-cholesten-3-one into 7 alpha, 12 alpha-dihydroxy-4-cholesten-3-one. Responsible for the balance between formation of cholic acid and chenodeoxycholic acid. Has a rather broad substrate specificity including a number of 7-alpha- hydroxylated C27 steroids. Belongs to the cytochrome P450 family.

Protein type: Membrane protein, integral; Oxidoreductase; EC 1.14.13.95; Lipid Metabolism - primary bile acid biosynthesis

Chromosomal Location of Human Ortholog: 3p22.1

Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane

Molecular Function: sterol 12-alpha-hydroxylase activity; iron ion binding; 7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase activity; heme binding; oxygen binding

Biological Process: bile acid biosynthetic process; bile acid metabolic process; xenobiotic metabolic process; lipid metabolic process; sterol metabolic process

Research Articles on CYP8B1

Similar Products

Product Notes

The CYP8B1 cyp8b1 (Catalog #AAA3214675) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYP8B1 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYP8B1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CYP8B1 cyp8b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLLWPREWLE VGRLQRLFHK MLSVSHSQEK EGISNWLGNM LQFLREQGVP. It is sometimes possible for the material contained within the vial of "CYP8B1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual