Rabbit anti-Human CYP4V2 Polyclonal Antibody | anti-CYP4V2 antibody

CYP4V2 (Cytochrome P450 4V2, FLJ18432, MGC43534)

Cat. Num. AAA649880

• Gene Names: CYP4V2; BCD; CYP4AH1
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: CYP4V2; Polyclonal Antibody; CYP4V2 (Cytochrome P450 4V2; FLJ18432; MGC43534); Anti -CYP4V2 (Cytochrome P450 4V2; anti-CYP4V2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CYP4V2.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAGLWLGLVWQKLLLWGAASALSLAGASLVLSLLQRVASYARKWQQMRPIPTVARAYPLVGHALLMKPDGREFFQQIIEYTEEYRHMPLLKLWVGPVPMVALYNAENVEVILTSSKQIDKSSMYKFLEPWLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKHINQEAFNCFFYITLCALDIICETAMGKNIGAQSNDDSEYVRAVYRMSEMIFRRIKMPWLWLDLWYLMFKEGWEHKKSLKILHTFTNSVIAERANEMNANEDCRGDGRGSAPSKNKRRAFLDLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHFWIESNQKREELGLEGQLILRPSNGIWIKLKRRNADER

• Applicable Applications for anti-CYP4V2 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human CYP4V2, aa1-525 (NP_997235.2).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(CYP4V2 rabbit polyclonal antibody. Western Blot analysis of CYP4V2 expression in human kidney.)

Western Blot (WB)

(Western Blot analysis of CYP4V2 expression in transfected 293T cell line by CYP4V2 polyclonal antibody. Lane 1: CYP4V2 transfected lysate (60.7kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-CYP4V2 antibody

Catalyzes the omega-hydroxylation of medium-chain saturated fatty acids such as laurate, myristate and palmitate in an NADPH-dependent pathway. The substrate specificity is higher for myristate > laurate > palmitate (C14>C16>C12). May have a role in fatty acid and steroid metabolism in the eye.

Product Categories/Family for anti-CYP4V2 antibody

Antibodies; Abs to Cytochrome

NCBI and Uniprot Product Information

• NCBI GI #: 187960086
• NCBI GeneID: 285440
• NCBI Accession #: NP_997235.3
• NCBI GenBank Nucleotide #: NM_207352.3
• UniProt Accession #: Q6ZWL3; Q6ZTM4; B7U6W2
• Molecular Weight: 60,724 Da
• NCBI Official Full Name: cytochrome P450 4V2
• NCBI Official Synonym Full Names: cytochrome P450, family 4, subfamily V, polypeptide 2
• NCBI Official Symbol: CYP4V2
• NCBI Official Synonym Symbols: BCD; CYP4AH1
• NCBI Protein Information: cytochrome P450 4V2
• UniProt Protein Name: Cytochrome P450 4V2
• Protein Family: Cytochrome
• UniProt Gene Name: CYP4V2
• UniProt Entry Name: CP4V2_HUMAN

NCBI Description

This gene encodes a member of the cytochrome P450 hemethiolate protein superfamily which are involved in oxidizing various substrates in the metabolic pathway. It is implicated in the metabolism of fatty acid precursors into n-3 polyunsaturated fatty acids. Mutations in this gene result in Bietti crystalline corneoretinal dystrophy. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Catalyzes the omega-hydroxylation of medium-chain saturated fatty acids such as laurate, myristate and palmitate in an NADPH-dependent pathway. The substrate specificity is higher for myristate > laurate > palmitate (C14>C16>C12). May have a role in fatty acid and steroid metabolism in the eye. Ref.6

Cofactor: Heme group

By similarity.

Enzyme regulation: Inhibited by N-hydroxy-N'-(4-n-butyl-2-methylphenyl formamidine)(HET0016) with an IC50 of 38 nM. Ref.6

Subcellular location: Endoplasmic reticulum membrane; Single-pass membrane protein

Potential.

Tissue specificity: Broadly expressed. Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, retina, retinal pigment epithelium (RPE) and lymphocytes. Ref.1

Involvement in disease: Bietti crystalline corneoretinal dystrophy (BCD) [MIM:210370]: An autosomal recessive ocular disease characterized by retinal degeneration and marginal corneal dystrophy. Typical features include multiple glistening intraretinal crystals scattered over the fundus, a characteristic degeneration of the retina, and sclerosis of the choroidal vessels, ultimately resulting in progressive night blindness and constriction of the visual field. Most patients have similar crystals at the corneoscleral limbus. Patients develop decreased vision, nyctalopia, and paracentral scotomata between the 2nd and 4th decade of life. Later, they develop peripheral visual field loss and marked visual impairment, usually progressing to legal blindness by the 5th or 6th decade of life.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.1

Sequence similarities: Belongs to the cytochrome P450 family.

Biophysicochemical propertiesKinetic parameters:Vmax is the nearly the same for myristic acid and for lauric acid and reduced about 30% for palmitic acid.KM=65 µM for myristic acid Ref.6KM=140 µM for lauric acidKM=430 µM for palmitic acid