Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SLC24A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)

Rabbit SLC24A1 Polyclonal Antibody | anti-SLC24A1 antibody

SLC24A1 antibody - middle region

Gene Names
SLC24A1; NCKX; RODX; NCKX1; CSNB1D; HsT17412
Reactivity
Dog, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC24A1; Polyclonal Antibody; SLC24A1 antibody - middle region; anti-SLC24A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EQLSRRPVAKVMALEDLSKPGDGAIAVDELQDNKKLKLPSLLTRGSSSTS
Sequence Length
1099
Applicable Applications for anti-SLC24A1 antibody
Western Blot (WB)
Homology
Dog: 79%; Human: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC24A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SLC24A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-SLC24A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)
Related Product Information for anti-SLC24A1 antibody
This is a rabbit polyclonal antibody against SLC24A1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SLC24A1 belongs to a family of potassium-dependent sodium/calcium exchangers. Members of this family have 2 large hydrophilic loops and 2 sets of multiple transmembrane-spanning segments.SLC24A1 belongs to a family of potassium-dependent sodium/calcium exchangers. Members of this family have 2 large hydrophilic loops and 2 sets of multiple transmembrane-spanning segments (Schnetkamp, 2004 [PubMed 14770312]).[supplied by OMIM].
Product Categories/Family for anti-SLC24A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
121kDa
NCBI Official Full Name
sodium/potassium/calcium exchanger 1 isoform 1
NCBI Official Synonym Full Names
solute carrier family 24 member 1
NCBI Official Symbol
SLC24A1
NCBI Official Synonym Symbols
NCKX; RODX; NCKX1; CSNB1D; HsT17412
NCBI Protein Information
sodium/potassium/calcium exchanger 1
UniProt Protein Name
Sodium/potassium/calcium exchanger 1
UniProt Gene Name
SLC24A1
UniProt Synonym Gene Names
KIAA0702; NCKX1
UniProt Entry Name
NCKX1_HUMAN

NCBI Description

This gene encodes a member of the potassium-dependent sodium/calcium exchanger protein family. The encoded protein plays an important role in sodium/calcium exchange in retinal rod and cone photoreceptors by mediating the extrusion of one calcium ion and one potassium ion in exchange for four sodium ions. Mutations in this gene may play a role in congenital stationary night blindness. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

SLC24A1: Critical component of the visual transduction cascade, controlling the calcium concentration of outer segments during light and darkness. Light causes a rapid lowering of cytosolic free calcium in the outer segment of both retinal rod and cone photoreceptors and the light-induced lowering of calcium is caused by extrusion via this protein which plays a key role in the process of light adaptation. Transports 1 Ca(2+) and 1 K(+) in exchange for 4 Na(+). Defects in SLC24A1 are the cause of congenital stationary night blindness type 1D (CSNB1D). An autosomal recessive form of congenital stationary night blindness a non- progressive retinal disorder characterized by impaired night vision. CSNB1D is characterized by a Riggs type of electroretinogram (proportionally reduced a- and b-waves). Patients have visual acuity within the normal range and no symptoms of myopia and/or nystagmus. Belongs to the sodium/potassium/calcium exchanger family. SLC24A subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Transporter, SLC family; Membrane protein, multi-pass; Transporter

Chromosomal Location of Human Ortholog: 15q22

Cellular Component: membrane; integral to plasma membrane; outer membrane; plasma membrane

Molecular Function: protein binding; calcium, potassium:sodium antiporter activity; symporter activity

Biological Process: rhodopsin mediated signaling; phototransduction, visible light; visual perception; transport; calcium ion transport; response to light intensity; ion transport; transmembrane transport

Disease: Night Blindness, Congenital Stationary, Type 1d

Research Articles on SLC24A1

Similar Products

Product Notes

The SLC24A1 slc24a1 (Catalog #AAA3207086) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC24A1 antibody - middle region reacts with Dog, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC24A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC24A1 slc24a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EQLSRRPVAK VMALEDLSKP GDGAIAVDEL QDNKKLKLPS LLTRGSSSTS. It is sometimes possible for the material contained within the vial of "SLC24A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.