Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of CYP17A1 expression in 22RV1 whole cell lysates (lane 1). CYP17A1 at 57KD was detected using rabbit anti- CYP17A1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit anti-Human CYP17A1 Polyclonal Antibody | anti-CYP17A1 antibody

Anti-CYP17A1 Antibody

Gene Names
CYP17A1; CPT7; CYP17; S17AH; P450C17
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen affinity purified.
Synonyms
CYP17A1; Polyclonal Antibody; Anti-CYP17A1 Antibody; 20 lyase; CPT7; CYP17; CYPXVII; P450 C17; P450c17; S17AH; P05093; Steroid 17-alpha-hydroxylase/17; cytochrome P450 family 17 subfamily A member 1; anti-CYP17A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
508
Applicable Applications for anti-CYP17A1 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot: 0.1-0.5ug/ml
Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human CYP17A1 (383-419aa EFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLN), different from the related mouse and rat sequences by ten amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of CYP17A1 expression in 22RV1 whole cell lysates (lane 1). CYP17A1 at 57KD was detected using rabbit anti- CYP17A1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of CYP17A1 expression in 22RV1 whole cell lysates (lane 1). CYP17A1 at 57KD was detected using rabbit anti- CYP17A1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Immunohistochemistry (IHC)

(CYP17A1 was detected in paraffin-embedded sections of human testis tissues using rabbit anti- CYP17A1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC) (CYP17A1 was detected in paraffin-embedded sections of human testis tissues using rabbit anti- CYP17A1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )
Related Product Information for anti-CYP17A1 antibody
Rabbit IgG polyclonal antibody for Steroid 17-alpha-hydroxylase/17, 20 lyase(CYP17A1) detection.
Background: Cytochrome P450 17A1, also called steroid 17alpha-monooxygenase, is an enzyme of the hydroxylase type that in humans is encoded by the CYP17A1 gene on chromosome 10. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. It has both 17alpha-hydroxylase and 17, 20-lyase activities and is a key enzyme in the steroidogenic pathway that produces progestins, mineralocorticoids, glucocorticoids, androgens, and estrogens. Mutations in this gene are associated with isolated steroid-17 alpha-hydroxylase deficiency, 17-alpha-hydroxylase/17, 20-lyase deficiency, pseudohermaphroditism, and adrenal hyperplasia.
References
1. DeVore NM, Scott EE (February 2012). "Structures of cytochrome P450 17A1 with prostate cancer drugs abiraterone and TOK-001". Nature. 482(7383): 116-9.
2. Estrada DF, Laurence JS, Scott EE (February 2016). "Cytochrome P450 17A1 Interactions with the FMN Domain of Its Reductase as Characterized by NMR". The Journal of Biological Chemistry. 291 (8): 3990-4003.
3. Petrunak EM, DeVore NM, Porubsky PR, Scott EE (November 2014). "Structures of human steroidogenic cytochrome P450 17A1 with substrates".The Journal of Biological Chemistry. 289 (47): 32952-64.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57,371 Da
NCBI Official Full Name
steroid 17-alpha-hydroxylase/17,20 lyase
NCBI Official Synonym Full Names
cytochrome P450 family 17 subfamily A member 1
NCBI Official Symbol
CYP17A1
NCBI Official Synonym Symbols
CPT7; CYP17; S17AH; P450C17
NCBI Protein Information
steroid 17-alpha-hydroxylase/17,20 lyase
UniProt Protein Name
Steroid 17-alpha-hydroxylase/17,20 lyase
UniProt Gene Name
CYP17A1
UniProt Synonym Gene Names
CYP17; S17AH; Cytochrome P450c17

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. It has both 17alpha-hydroxylase and 17,20-lyase activities and is a key enzyme in the steroidogenic pathway that produces progestins, mineralocorticoids, glucocorticoids, androgens, and estrogens. Mutations in this gene are associated with isolated steroid-17 alpha-hydroxylase deficiency, 17-alpha-hydroxylase/17,20-lyase deficiency, pseudohermaphroditism, and adrenal hyperplasia. [provided by RefSeq, Jul 2008]

Uniprot Description

CYP17A1: Conversion of pregnenolone and progesterone to their 17- alpha-hydroxylated products and subsequently to dehydroepiandrosterone (DHEA) and androstenedione. Catalyzes both the 17-alpha-hydroxylation and the 17,20-lyase reaction. Involved in sexual development during fetal life and at puberty. Defects in CYP17A1 are the cause of adrenal hyperplasia type 5 (AH5). AH5 is a form of congenital adrenal hyperplasia, a common recessive disease due to defective synthesis of cortisol. Congenital adrenal hyperplasia is characterized by androgen excess leading to ambiguous genitalia in affected females, rapid somatic growth during childhood in both sexes with premature closure of the epiphyses and short adult stature. Four clinical types: salt wasting (SW, the most severe type), simple virilizing (SV, less severely affected patients), with normal aldosterone biosynthesis, non-classic form or late onset (NC or LOAH), and cryptic (asymptomatic). Belongs to the cytochrome P450 family.

Protein type: EC 1.14.99.9; EC 4.1.2.30; Lipid Metabolism - C21-steroid hormone; Oxidoreductase

Chromosomal Location of Human Ortholog: 10q24.32

Cellular Component: endoplasmic reticulum membrane

Molecular Function: 17-alpha-hydroxyprogesterone aldolase activity; heme binding; oxygen binding; steroid 17-alpha-monooxygenase activity

Biological Process: androgen biosynthetic process; glucocorticoid biosynthetic process; hormone biosynthetic process; progesterone metabolic process; steroid biosynthetic process; steroid metabolic process; sterol metabolic process

Disease: Adrenal Hyperplasia, Congenital, Due To 17-alpha-hydroxylase Deficiency

Research Articles on CYP17A1

Similar Products

Product Notes

The CYP17A1 cyp17a1 (Catalog #AAA178614) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-CYP17A1 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYP17A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot: 0.1-0.5ug/ml Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml. Researchers should empirically determine the suitability of the CYP17A1 cyp17a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CYP17A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.