Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type: Monkey adrenal glandSample Type :Monkey adrenal glandPrimary Antibody Dilution :1:25Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Color/Signal Descriptions:Brown: CYP11B1 Blue: NucleusGene Name:CYP11B1Submitted by:Jonathan Bertin, Endoceutics Inc.)

Rabbit CYP11B1 Polyclonal Antibody | anti-CYP11B1 antibody

CYP11B1 antibody - C-terminal region

Gene Names
CYP11B1; FHI; CPN1; CYP11B; P450C11
Reactivity
Human, Pig, Sheep, Monkey
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CYP11B1; Polyclonal Antibody; CYP11B1 antibody - C-terminal region; anti-CYP11B1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Pig, Sheep, Monkey
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL
Sequence Length
503
Applicable Applications for anti-CYP11B1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Human: 100%; Pig: 79%; Sheep: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CYP11B1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type: Monkey adrenal glandSample Type :Monkey adrenal glandPrimary Antibody Dilution :1:25Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Color/Signal Descriptions:Brown: CYP11B1 Blue: NucleusGene Name:CYP11B1Submitted by:Jonathan Bertin, Endoceutics Inc.)

Immunohistochemistry (IHC) (Sample Type: Monkey adrenal glandSample Type :Monkey adrenal glandPrimary Antibody Dilution :1:25Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Color/Signal Descriptions:Brown: CYP11B1 Blue: NucleusGene Name:CYP11B1Submitted by:Jonathan Bertin, Endoceutics Inc.)

Immunohistochemistry (IHC)

(Sample Type: Monkey vaginaSample Type :Monkey vaginaPrimary Antibody Dilution :1:25Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Color/Signal Descriptions:Brown: CYP11B1 Blue: NucleusGene Name:CYP11B1Submitted by:Jonathan Bertin, Endoceutics Inc.)

Immunohistochemistry (IHC) (Sample Type: Monkey vaginaSample Type :Monkey vaginaPrimary Antibody Dilution :1:25Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Color/Signal Descriptions:Brown: CYP11B1 Blue: NucleusGene Name:CYP11B1Submitted by:Jonathan Bertin, Endoceutics Inc.)

Western Blot (WB)

(Sample Type: r-CYP11B1Sample type: 1. HEK293TN-GFP-hcyp11B1 (75ug)2. HEK293TN-GFP-hcyp11B2 (75ug)Primary dilution: 1:100Secondary Antibody: mouse anti-Rabbit HRPSecondary Dilution: 1:10,000Film Exposed for: 5 minutesImage Submitted by: Celso Gomez-SanchezMongomery VA Medical Center)

Western Blot (WB) (Sample Type: r-CYP11B1Sample type: 1. HEK293TN-GFP-hcyp11B1 (75ug)2. HEK293TN-GFP-hcyp11B2 (75ug)Primary dilution: 1:100Secondary Antibody: mouse anti-Rabbit HRPSecondary Dilution: 1:10,000Film Exposed for: 5 minutesImage Submitted by: Celso Gomez-SanchezMongomery VA Medical Center)

Western Blot (WB)

(Host: RabbitTarget Name: CYP11B1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CYP11B1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-CYP11B1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-CYP11B1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)
Related Product Information for anti-CYP11B1 antibody
This is a rabbit polyclonal antibody against CYP11B1. It was validated on Western Blot

Target Description: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and is involved in the conversion of progesterone to cortisol in the adrenal cortex. Mutations in this gene cause congenital adrenal hyperplasia due to 11-beta-hydroxylase deficiency. Transcript variants encoding different isoforms have been noted for this gene.
Product Categories/Family for anti-CYP11B1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
cytochrome P450 11B1, mitochondrial isoform 1
NCBI Official Synonym Full Names
cytochrome P450 family 11 subfamily B member 1
NCBI Official Symbol
CYP11B1
NCBI Official Synonym Symbols
FHI; CPN1; CYP11B; P450C11
NCBI Protein Information
cytochrome P450 11B1, mitochondrial
UniProt Protein Name
Cytochrome P450 11B1, mitochondrial
Protein Family
UniProt Gene Name
CYP11B1
UniProt Synonym Gene Names
S11BH; Cytochrome P450C11
UniProt Entry Name
C11B1_HUMAN

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and is involved in the conversion of progesterone to cortisol in the adrenal cortex. Mutations in this gene cause congenital adrenal hyperplasia due to 11-beta-hydroxylase deficiency. Transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CYP11B1: Has steroid 11-beta-hydroxylase activity. In addition to this activity, the 18 or 19-hydroxylation of steroids and the aromatization of androstendione to estrone have also been ascribed to cytochrome P450 XIB. Defects in CYP11B1 are the cause of adrenal hyperplasia type 4 (AH4). AH4 is a form of congenital adrenal hyperplasia, a common recessive disease due to defective synthesis of cortisol. Congenital adrenal hyperplasia is characterized by androgen excess leading to ambiguous genitalia in affected females, rapid somatic growth during childhood in both sexes with premature closure of the epiphyses and short adult stature. Four clinical types: salt wasting (SW, the most severe type), simple virilizing (SV, less severely affected patients), with normal aldosterone biosynthesis, non-classic form or late onset (NC or LOAH), and cryptic (asymptomatic). AH4 patients usually have hypertension. Defects in CYP11B1 are a cause of familial hyperaldosteronism type 1 (FH1). It is a disorder characterized by hypertension, variable hyperaldosteronism, and abnormal adrenal steroid production, including 18-oxocortisol and 18-hydroxycortisol. There is significant phenotypic heterogeneity, and some individuals never develop hypertension. The molecular defect causing hyperaldosteronism familial type 1 is an anti-Lepore-type fusion of the CYP11B1 and CYP11B2 genes. The hybrid gene has the promoting part of CYP11B1, ACTH-sensitive, and the coding part of CYP11B2. Belongs to the cytochrome P450 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Oxidoreductase; EC 1.14.15.4; Lipid Metabolism - C21-steroid hormone; Mitochondrial; Lipid Metabolism - androgen and estrogen

Chromosomal Location of Human Ortholog: 8q21

Cellular Component: mitochondrion; mitochondrial inner membrane

Molecular Function: steroid 11-beta-monooxygenase activity; iron ion binding; heme binding

Biological Process: steroid metabolic process; regulation of blood pressure; xenobiotic metabolic process; C21-steroid hormone biosynthetic process; immune response; glucocorticoid biosynthetic process; glucose homeostasis; sterol metabolic process; aldosterone biosynthetic process; cellular response to hormone stimulus

Disease: Glucocorticoid-remediable Aldosteronism; Adrenal Hyperplasia, Congenital, Due To Steroid 11-beta-hydroxylase Deficiency

Research Articles on CYP11B1

Similar Products

Product Notes

The CYP11B1 cyp11b1 (Catalog #AAA3214676) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYP11B1 antibody - C-terminal region reacts with Human, Pig, Sheep, Monkey and may cross-react with other species as described in the data sheet. AAA Biotech's CYP11B1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the CYP11B1 cyp11b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ARNPNVQQAL RQESLAAAAS ISEHPQKATT ELPLLRAALK ETLRLYPVGL. It is sometimes possible for the material contained within the vial of "CYP11B1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.