Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CCND3 rabbit polyclonal antibody. Western Blot analysis of CCND3 expression in Jurkat.)

Rabbit anti-Human Cyclin D3 Polyclonal Antibody | anti-CCND3 antibody

Cyclin D3 (G1/S-specific Cyclin-D3, CCND3) (HRP)

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Cyclin D3; Polyclonal Antibody; Cyclin D3 (G1/S-specific Cyclin-D3; CCND3) (HRP); anti-CCND3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CCND3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-CCND3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CCND3, aa1-292 (NP_001751.1).
Immunogen Sequence
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(CCND3 rabbit polyclonal antibody. Western Blot analysis of CCND3 expression in Jurkat.)

Western Blot (WB) (CCND3 rabbit polyclonal antibody. Western Blot analysis of CCND3 expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of CCND3 expression in transfected 293T cell line by CCND3 polyclonal antibody. Lane 1: CCND3 transfected lysate (32.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CCND3 expression in transfected 293T cell line by CCND3 polyclonal antibody. Lane 1: CCND3 transfected lysate (32.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CCND3 and AREG. HeLa cells were stained with CCND3 rabbit purified polyclonal 1:1200 and AREG mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between CCND3 and AREG. HeLa cells were stained with CCND3 rabbit purified polyclonal 1:1200 and AREG mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-CCND3 antibody
Cyclin D3 is a G1 cyclin closely related to cyclin D1 and D2. Cyclins D1, D2, and D3 form active kinase complexes in vivo with a distinct subset of cdks, particularly with cdk4 and cdk6.
Product Categories/Family for anti-CCND3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
896
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
9,736 Da
NCBI Official Full Name
Homo sapiens cyclin D3 (CCND3), transcript variant 2, mRNA
NCBI Official Synonym Full Names
cyclin D3
NCBI Official Symbol
CCND3
NCBI Protein Information
G1/S-specific cyclin-D3; D3-type cyclin
Protein Family

NCBI Description

The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activtiy is required for cell cycle G1/S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. The CDK4 activity associated with this cyclin was reported to be necessary for cell cycle progression through G2 phase into mitosis after UV radiation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]

Research Articles on CCND3

Similar Products

Product Notes

The CCND3 (Catalog #AAA6375307) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cyclin D3 (G1/S-specific Cyclin-D3, CCND3) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Cyclin D3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CCND3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cyclin D3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.