Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-CYBA AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Plasma membrane in intercalated diskPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit CYBA Polyclonal Antibody | anti-CYBA antibody

CYBA antibody - middle region

Gene Names
CYBA; p22-PHOX
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
CYBA; Polyclonal Antibody; CYBA antibody - middle region; anti-CYBA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPP
Sequence Length
195
Applicable Applications for anti-CYBA antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 93%; Dog: 79%; Horse: 79%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 79%; Rat: 86%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CYBA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-CYBA AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Plasma membrane in intercalated diskPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-CYBA AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Plasma membrane in intercalated diskPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-CYBA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Small Intestine)

Western Blot (WB) (WB Suggested Anti-CYBA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Small Intestine)
Related Product Information for anti-CYBA antibody
This is a rabbit polyclonal antibody against CYBA. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Cytochrome b is comprised of a light chain (alpha) and a heavy chain (beta). This gene encodes the light, alpha subunit which has been proposed as a primary component of the microbicidal oxidase system of phagocytes. Mutations in this gene are associated

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
cytochrome b-245 light chain
NCBI Official Synonym Full Names
cytochrome b-245 alpha chain
NCBI Official Symbol
CYBA
NCBI Official Synonym Symbols
p22-PHOX
NCBI Protein Information
cytochrome b-245 light chain
UniProt Protein Name
Cytochrome b-245 light chain
Protein Family
UniProt Gene Name
CYBA
UniProt Synonym Gene Names
p22phox
UniProt Entry Name
CY24A_HUMAN

NCBI Description

Cytochrome b is comprised of a light chain (alpha) and a heavy chain (beta). This gene encodes the light, alpha subunit which has been proposed as a primary component of the microbicidal oxidase system of phagocytes. Mutations in this gene are associated with autosomal recessive chronic granulomatous disease (CGD), that is characterized by the failure of activated phagocytes to generate superoxide, which is important for the microbicidal activity of these cells. [provided by RefSeq, Jul 2008]

Uniprot Description

CYBA: Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. Associates with NOX3 to form a functional NADPH oxidase constitutively generating superoxide. Defects in CYBA are a cause of chronic granulomatous disease autosomal recessive cytochrome-b-negative (ARCGD). Chronic granulomatous disease is a genetically heterogeneous disorder characterized by the inability of neutrophils and phagocytes to kill microbes that they have ingested. Patients suffer from life-threatening bacterial/fungal infections. Belongs to the p22phox family.

Protein type: Oxidoreductase; Membrane protein, integral; EC 1.-.-.-

Chromosomal Location of Human Ortholog: 16q24

Cellular Component: Golgi apparatus; phagocytic vesicle membrane; membrane; cell soma; mitochondrion; apical plasma membrane; dendrite; plasma membrane; endosome; secretory granule; NADPH oxidase complex

Molecular Function: protein binding; electron carrier activity; protein heterodimerization activity; metal ion binding; superoxide-generating NADPH oxidase activity; heme binding; SH3 domain binding

Biological Process: response to drug; respiratory burst; response to nutrient levels; interaction with host; angiotensin-mediated regulation of glomerular filtration; superoxide metabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; positive regulation of cell growth; regulation of release of sequestered calcium ion into cytosol; antigen processing and presentation of peptide antigen via MHC class I; cytochrome complex assembly; antigen processing and presentation of exogenous peptide antigen via MHC class I; innate immune response; smooth muscle hypertrophy; positive regulation of endothelial cell proliferation; inflammatory response; vascular endothelial growth factor receptor signaling pathway; superoxide release; hydrogen peroxide biosynthetic process

Disease: Granulomatous Disease, Chronic, Autosomal Recessive, Cytochrome B-negative

Research Articles on CYBA

Similar Products

Product Notes

The CYBA cyba (Catalog #AAA3207261) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYBA antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CYBA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the CYBA cyba for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TILGTACLAI ASGIYLLAAV RGEQWTPIEP KPRERPQIGG TIKQPPSNPP. It is sometimes possible for the material contained within the vial of "CYBA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.