Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CXORF34 antibody (MBS5300836) used at 2.5 ug/ml to detect target protein.)

Rabbit CXORF34 Polyclonal Antibody | anti-CXORF34 antibody

CXORF34 antibody

Gene Names
TRMT2B; CXorf34; dJ341D10.3
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
CXORF34; Polyclonal Antibody; CXORF34 antibody; Polyclonal CXORF34; Anti-CXORF34; Chromosome X Open Reading Frame 34; FLJ12687; dJ341D10.3; anti-CXORF34 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
CXORF34 antibody was raised against the middle region of Cxorf34
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CXORF34 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
504
Applicable Applications for anti-CXORF34 antibody
Western Blot (WB)
Application Notes
WB: 2.5 ug/ml
Biological Significance
CXorf34 is a putative methyltransferase.
Cross-Reactivity
Human
Immunogen
CXORF34 antibody was raised using the middle region of Cxorf34 corresponding to a region with amino acids GAACGLTSLYFQESTMTRCSHQQSPYQLLFGEPYIFEELLSLKIRISPDA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(CXORF34 antibody (MBS5300836) used at 2.5 ug/ml to detect target protein.)

Western Blot (WB) (CXORF34 antibody (MBS5300836) used at 2.5 ug/ml to detect target protein.)
Related Product Information for anti-CXORF34 antibody
Rabbit polyclonal CXORF34 antibody raised against the middle region of Cxorf34
Product Categories/Family for anti-CXORF34 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
56 kDa (MW of target protein)
NCBI Official Full Name
chromosome X open reading frame 34, isoform CRA_a
NCBI Official Synonym Full Names
tRNA methyltransferase 2 homolog B (S. cerevisiae)
NCBI Official Symbol
TRMT2B
NCBI Official Synonym Symbols
CXorf34; dJ341D10.3
NCBI Protein Information
tRNA (uracil(54)-C(5))-methyltransferase homolog
UniProt Protein Name
tRNA (uracil(54)-C(5))-methyltransferase homolog
UniProt Gene Name
TRMT2B
UniProt Synonym Gene Names
CXorf34
UniProt Entry Name
TRM2_HUMAN

NCBI Description

This gene encodes a homolog of the TRM2 gene in S. cerevisiae. The yeast gene encodes a tRNA methyltransferase that plays a role in tRNA maturation. The yeast protein also has endo-exonuclease activity and may be involved in DNA double strand break repair. Alternative splicing results in multiple transcripts encoding different isoforms. [provided by RefSeq, Nov 2009]

Uniprot Description

TRMT2B: Probable S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the formation of 5-methyl-uridine at position 54 (m5U54) in all tRNA. May also have a role in tRNA stabilization or maturation. Belongs to the methyltransferase superfamily. RNA M5U methyltransferase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Methyltransferase; EC 2.1.1.35

Chromosomal Location of Human Ortholog: Xq22.1

Cellular Component: mitochondrion

Molecular Function: S-adenosylmethionine-dependent tRNA (m5U54) methyltransferase activity

Biological Process: RNA processing; tRNA processing; RNA methylation

Similar Products

Product Notes

The CXORF34 trmt2b (Catalog #AAA5300836) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CXORF34 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 2.5 ug/ml. Researchers should empirically determine the suitability of the CXORF34 trmt2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CXORF34, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.