Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CXCL1 Antibody Titration: 0.0758ug/mlPositive Control: Human Small Intestine)

Rabbit CXCL1 Polyclonal Antibody | anti-CXCL1 antibody

CXCL1 antibody - middle region

Gene Names
CXCL1; FSP; GRO1; GROa; MGSA; NAP-3; SCYB1; MGSA-a
Reactivity
Cow, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CXCL1; Polyclonal Antibody; CXCL1 antibody - middle region; anti-CXCL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Sequence Length
107
Applicable Applications for anti-CXCL1 antibody
Western Blot (WB)
Homology
Cow: 90%; Human: 100%; Pig: 85%; Rabbit: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CXCL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CXCL1 Antibody Titration: 0.0758ug/mlPositive Control: Human Small Intestine)

Western Blot (WB) (WB Suggested Anti-CXCL1 Antibody Titration: 0.0758ug/mlPositive Control: Human Small Intestine)
Related Product Information for anti-CXCL1 antibody
This is a rabbit polyclonal antibody against CXCL1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC, based on the arrangement of the first 2 of the 4 conserved cysteine residues; the 2 cysteines are separated by a single amino acid in CXC chemokines and are adjacent in CC chemokines. CXC chemokines are further subdivided into ELR and non-ELR types based on the presence or absence of a glu-leu-arg sequence adjacent and N terminal to the CXC motif.Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC, based on the arrangement of the first 2 of the 4 conserved cysteine residues; the 2 cysteines are separated by a single amino acid in CXC chemokines and are adjacent in CC chemokines. CXC chemokines are further subdivided into ELR and non-ELR types based on the presence or absence of a glu-leu-arg sequence adjacent and N terminal to the CXC motif.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
8kDa
NCBI Official Full Name
growth-regulated alpha protein
NCBI Official Synonym Full Names
C-X-C motif chemokine ligand 1
NCBI Official Symbol
CXCL1
NCBI Official Synonym Symbols
FSP; GRO1; GROa; MGSA; NAP-3; SCYB1; MGSA-a
NCBI Protein Information
growth-regulated alpha protein
UniProt Protein Name
Growth-regulated alpha protein
UniProt Gene Name
CXCL1
UniProt Synonym Gene Names
GRO; GRO1; GROA; MGSA; SCYB1; MGSA; NAP-3
UniProt Entry Name
GROA_HUMAN

NCBI Description

This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. Aberrant expression of this protein is associated with the growth and progression of certain tumors. A naturally occurring processed form of this protein has increased chemotactic activity. Alternate splicing results in coding and non-coding variants of this gene. A pseudogene of this gene is found on chromosome 4. [provided by RefSeq, Sep 2014]

Uniprot Description

CXCL1: Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO- alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Secreted; Motility/polarity/chemotaxis; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: extracellular space; extracellular region

Molecular Function: growth factor activity; chemokine activity; CXCR chemokine receptor binding; enzyme activator activity; receptor binding

Biological Process: positive regulation of catalytic activity; negative regulation of cell proliferation; cell proliferation; nervous system development; G-protein coupled receptor protein signaling pathway; immune response; response to lipopolysaccharide; positive regulation of leukocyte chemotaxis; inflammatory response; actin cytoskeleton organization and biogenesis; chemotaxis; signal transduction

Research Articles on CXCL1

Similar Products

Product Notes

The CXCL1 cxcl1 (Catalog #AAA3224416) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CXCL1 antibody - middle region reacts with Cow, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's CXCL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CXCL1 cxcl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QSVNVKSPGP HCAQTEVIAT LKNGRKACLN PASPIVKKII EKMLNSDKSN. It is sometimes possible for the material contained within the vial of "CXCL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.