Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using CTU2 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Rabbit anti-Human CTU2 Polyclonal Antibody | anti-CTU2 antibody
CTU2 Polyclonal Antibody
Gene Names
CTU2; NCS2; UPF0432; C16orf84
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
CTU2; Polyclonal Antibody; CTU2 Polyclonal Antibody; C16orf84; NCS2; UPF0432; anti-CTU2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
HVLGAGGGPGPTQGEEQPPQPPLDPQNLARPPAPAQTEALSQLFCSVRTLTAKEELLQTLRTHLILHMARAHGYSKVMTGDSCTRLAIKLMTNLALGRGAFLAWDTGFSDERHGDVVVVRPMRDHTLKEVAFYNRLFSVPSVFTPAVDTKAPEKASIHRLMEAFILRLQTQFPSTVSTVYRTSEKLVKGPRDGPAAGDSGPRCLLCMCALDVDAADSATAFGAQTSSRLSQMQSPIPLTETRTPPGPCCSPGVGW
Sequence Length
515
Applicable Applications for anti-CTU2 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human CTU2
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm
Positive Samples
A-431, Jurkat
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using CTU2 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using CTU2 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-CTU2 antibody
This gene encodes a protein which is involved in the post-transcriptional modification of transfer RNAs (tRNAs). The encoded protein plays a role in thiolation of uridine residue present at the wobble position in a subset of tRNAs, resulting in enhanced codon reading accuracy. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-CTU2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 46kDa; 52kDa; 56kDa
Observed: 56kDa
Observed: 56kDa
NCBI Official Full Name
cytoplasmic tRNA 2-thiolation protein 2 isoform 1
NCBI Official Synonym Full Names
cytosolic thiouridylase subunit 2
NCBI Official Symbol
CTU2
NCBI Official Synonym Symbols
NCS2; UPF0432; C16orf84
NCBI Protein Information
cytoplasmic tRNA 2-thiolation protein 2
UniProt Protein Name
Cytoplasmic tRNA 2-thiolation protein 2
UniProt Gene Name
CTU2
NCBI Description
This gene encodes a protein which is involved in the post-transcriptional modification of transfer RNAs (tRNAs). The encoded protein plays a role in thiolation of uridine residue present at the wobble position in a subset of tRNAs, resulting in enhanced codon reading accuracy. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016]
Uniprot Description
Plays a central role in 2-thiolation of mcm5S2U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). May act by forming a heterodimer with CTU1/ATPBD3 that ligates sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position.
Research Articles on CTU2
Similar Products
Product Notes
The CTU2 ctu2 (Catalog #AAA9133054) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CTU2 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CTU2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the CTU2 ctu2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HVLGAGGGPG PTQGEEQPPQ PPLDPQNLAR PPAPAQTEAL SQLFCSVRTL TAKEELLQTL RTHLILHMAR AHGYSKVMTG DSCTRLAIKL MTNLALGRGA FLAWDTGFSD ERHGDVVVVR PMRDHTLKEV AFYNRLFSVP SVFTPAVDTK APEKASIHRL MEAFILRLQT QFPSTVSTVY RTSEKLVKGP RDGPAAGDSG PRCLLCMCAL DVDAADSATA FGAQTSSRLS QMQSPIPLTE TRTPPGPCCS PGVGW. It is sometimes possible for the material contained within the vial of "CTU2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
