Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using RTKN antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

Rabbit RTKN Polyclonal Antibody | anti-RTKN antibody

RTKN Polyclonal Antibody

Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purification
Synonyms
RTKN; Polyclonal Antibody; RTKN Polyclonal Antibody; anti-RTKN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
PLCMTQPTASGTLRVQQAGEMQNWAQVHGVLKGTNLFCYRQPEDADTGEEPLLTIAVNKETRVRAGELDQALGRPFTLSISNQYGDDEVTHTLQTESREALQSWMEALWQLFFDMSQWKQCCDEIMKIETPAPRKPPQALAKQGSLYHEMAIEPLDDIAAVTDILTQREGARLETPPPWLAMFTDQPALPNPCSPASVAPAPDWTHPLPWGRPRTFSLDAVPPDHSPRARSVAPLPPQRSPRTRGLCSKGQPRTW
Sequence Length
563
Applicable Applications for anti-RTKN antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
WB: 1:500 - 1:2000
IF: 1:50 - 1:200
Immunogen
Recombinant protein of human RTKN
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using RTKN antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using RTKN antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

Immunofluorescence (IF)

(Immunofluorescence analysis of MCF-7 cells using RTKN antibody. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of MCF-7 cells using RTKN antibody. Blue: DAPI for nuclear staining.)
Related Product Information for anti-RTKN antibody
This gene encodes a scaffold protein that interacts with GTP-bound Rho proteins. Binding of this protein inhibits the GTPase activity of Rho proteins. This protein may interfere with the conversion of active, GTP-bound Rho to the inactive GDP-bound form by RhoGAP. Rho proteins regulate many important cellular processes, including cytokinesis, transcription, smooth muscle contraction, cell growth and transformation. Dysregulation of the Rho signal transduction pathway has been implicated in many forms of cancer. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-RTKN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 56kDa; 61kDa; 62kDa
Observed: 63kDa
NCBI Official Full Name
rhotekin isoform a
NCBI Official Synonym Full Names
rhotekin
NCBI Official Symbol
RTKN
NCBI Protein Information
rhotekin
UniProt Protein Name
Rhotekin
Protein Family
UniProt Gene Name
RTKN

NCBI Description

This gene encodes a scaffold protein that interacts with GTP-bound Rho proteins. Binding of this protein inhibits the GTPase activity of Rho proteins. This protein may interfere with the conversion of active, GTP-bound Rho to the inactive GDP-bound form by RhoGAP. Rho proteins regulate many important cellular processes, including cytokinesis, transcription, smooth muscle contraction, cell growth and transformation. Dysregulation of the Rho signal transduction pathway has been implicated in many forms of cancer. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

Mediates Rho signaling to activate NF-kappa-B and may confer increased resistance to apoptosis to cells in gastric tumorigenesis. May play a novel role in the organization of septin structures.

Research Articles on RTKN

Similar Products

Product Notes

The RTKN rtkn (Catalog #AAA9133392) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RTKN Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RTKN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). WB: 1:500 - 1:2000 IF: 1:50 - 1:200. Researchers should empirically determine the suitability of the RTKN rtkn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PLCMTQPTAS GTLRVQQAGE MQNWAQVHGV LKGTNLFCYR QPEDADTGEE PLLTIAVNKE TRVRAGELDQ ALGRPFTLSI SNQYGDDEVT HTLQTESREA LQSWMEALWQ LFFDMSQWKQ CCDEIMKIET PAPRKPPQAL AKQGSLYHEM AIEPLDDIAA VTDILTQREG ARLETPPPWL AMFTDQPALP NPCSPASVAP APDWTHPLPW GRPRTFSLDA VPPDHSPRAR SVAPLPPQRS PRTRGLCSKG QPRTW. It is sometimes possible for the material contained within the vial of "RTKN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.