Western Blot (WB)
(Western blot analysis of extracts of HeLa cells, using TRIT1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 15s.)
Rabbit anti-Human TRIT1 Polyclonal Antibody | anti-TRIT1 antibody
TRIT1 Polyclonal Antibody
Gene Names
TRIT1; IPT; GRO1; IPPT; MOD5; hGRO1; IPTase
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
TRIT1; Polyclonal Antibody; TRIT1 Polyclonal Antibody; GRO1; hGRO1; IPPT; IPT; IPTase; MOD5; anti-TRIT1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
GGEIVSADSMQVYEGLDIITNKVSAQEQRICRHHMISFVDPLVTNYTVVDFRNRATALIEDIFARDKIPIVVGGTNYYIESLLWKVLVNTKPQEMGTEKVIDRKVELEKEDGLVLHKRLSQVDPEMAAKLHPHDKRKVARSLQVFEETGISHSEFLHRQHTEEGGGPLGGPLKFSNPCILWLHADQAVLDERLDKRVDDMLAAGLLEELRDFHRRYNQKNVSENSQDYQHGIFQSIGFKEFHEYLITEGKCTL
Sequence Length
441
Applicable Applications for anti-TRIT1 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human TRIT1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, Mitochondrion
Positive Samples
HeLa
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of HeLa cells, using TRIT1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 15s.)
Western Blot (WB)
(Western blot analysis of extracts of HeLa cells, using TRIT1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 15s.)
Related Product Information for anti-TRIT1 antibody
This gene encodes a protein that that is targeted to the mitochondrion and modifies transfer RNAs (tRNAs) by adding a dimethylallyl group onto the adenine at position 37. This modification is important for maintaining the correct reading frame during protein translation. This gene is considered a tumor suppressor and its expression can decrease cell growth. Alternative splicing results in multiple transcripts variants, most of which are likely non-functional.
Product Categories/Family for anti-TRIT1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 18kDa; 37kDa; 43kDa; 49kDa; 52kDa
Observed: 53kDa
Observed: 53kDa
NCBI Official Full Name
tRNA dimethylallyltransferase isoform 2
NCBI Official Synonym Full Names
tRNA isopentenyltransferase 1
NCBI Official Symbol
TRIT1
NCBI Official Synonym Symbols
IPT; GRO1; IPPT; MOD5; hGRO1; IPTase
NCBI Protein Information
tRNA dimethylallyltransferase; tRNA dimethylallyltransferase, mitochondrial
UniProt Protein Name
tRNA dimethylallyltransferase
UniProt Gene Name
TRIT1
UniProt Synonym Gene Names
IPT; MOD5; IPP transferase; IPPT; IPTase
NCBI Description
This gene encodes a protein that that is targeted to the mitochondrion and modifies transfer RNAs (tRNAs) by adding a dimethylallyl group onto the adenine at position 37. This modification is important for maintaining the correct reading frame during protein translation. This gene is considered a tumor suppressor and its expression can decrease cell growth. Alternative splicing results in multiple transcripts variants, most of which are likely non-functional. [provided by RefSeq, Aug 2015]
Uniprot Description
Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 of both cytosolic and mitochondrial tRNAs, leading to the formation of N6-(dimethylallyl)adenosine (i6A).
Research Articles on TRIT1
Similar Products
Product Notes
The TRIT1 trit1 (Catalog #AAA9133149) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIT1 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRIT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the TRIT1 trit1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GGEIVSADSM QVYEGLDIIT NKVSAQEQRI CRHHMISFVD PLVTNYTVVD FRNRATALIE DIFARDKIPI VVGGTNYYIE SLLWKVLVNT KPQEMGTEKV IDRKVELEKE DGLVLHKRLS QVDPEMAAKL HPHDKRKVAR SLQVFEETGI SHSEFLHRQH TEEGGGPLGG PLKFSNPCIL WLHADQAVLD ERLDKRVDDM LAAGLLEELR DFHRRYNQKN VSENSQDYQH GIFQSIGFKE FHEYLITEGK CTL. It is sometimes possible for the material contained within the vial of "TRIT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
