Rabbit anti-Human CTSS Polyclonal Antibody | anti-CTSS antibody

CTSS (Cathepsin S, MGC3886) (Biotin)

Cat. Num. AAA6375085

• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CTSS; Polyclonal Antibody; CTSS (Cathepsin S; MGC3886) (Biotin); anti-CTSS antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CTSS.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-CTSS antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human CTSS, aa1-331 (NP_004070.3).
• Immunogen Sequence: MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CTSS expression in transfected 293T cell line by CTSS polyclonal antibody. Lane 1: CTSS transfected lysate (37.5kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-CTSS antibody

Cathepsin family of proteases contains several diverse classes of enzymes. The cysteine protease class comprises cathepsin B, H, K, L, O, and S. The aspartyl protease class contains cathepsin D and E. Cathepsin G belongs to the serine protease class. Cathepsins are involved in various cellular events such as peptide biosynthesis, protein degradation, and apoptosis. Cathepsin S has been shown to be present in aveloar macrophages.

Product Categories/Family for anti-CTSS antibody

Antibodies; Cathepsin

NCBI and Uniprot Product Information

• NCBI GI #: 23110962
• NCBI GeneID: 1520
• NCBI Accession #: NP_004070.3
• NCBI GenBank Nucleotide #: NM_004079
• UniProt Accession #: P25774; Q5T5I0; Q6FHS5; Q9BUG3; B4DWC9; D3DV05
• Molecular Weight: 31,626 Da
• NCBI Official Full Name: cathepsin S isoform 1 preproprotein
• NCBI Official Synonym Full Names: cathepsin S
• NCBI Official Symbol: CTSS
• NCBI Protein Information: cathepsin S
• UniProt Protein Name: Cathepsin S
• Protein Family: Cathepsin
• UniProt Gene Name: CTSS
• UniProt Entry Name: CATS_HUMAN

Uniprot Description

CTSS: Thiol protease. Key protease responsible for the removal of the invariant chain from MHC class II molecules. The bond- specificity of this proteinase is in part similar to the specificities of cathepsin L and cathepsin N. Belongs to the peptidase C1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; EC 3.4.22.27

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: lysosomal lumen; extracellular space; intracellular membrane-bound organelle; membrane; lysosome; extracellular region

Molecular Function: collagen binding; proteoglycan binding; cysteine-type endopeptidase activity; fibronectin binding; laminin binding

Biological Process: adaptive immune response; extracellular matrix organization and biogenesis; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-independent; antigen processing and presentation of exogenous peptide antigen via MHC class II; proteolysis; collagen catabolic process; antigen processing and presentation; extracellular matrix disassembly; antigen processing and presentation of peptide antigen via MHC class I; proteolysis involved in cellular protein catabolic process; toll-like receptor signaling pathway; innate immune response; antigen processing and presentation of exogenous peptide antigen via MHC class I; immune response; positive regulation of inflammatory response