Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CTRB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)

Rabbit CTRB1 Polyclonal Antibody | anti-CTRB1 antibody

CTRB1 antibody - N-terminal region

Gene Names
CTRB1; CTRB
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CTRB1; Polyclonal Antibody; CTRB1 antibody - N-terminal region; anti-CTRB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVS
Sequence Length
263
Applicable Applications for anti-CTRB1 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 92%; Guinea Pig: 85%; Horse: 92%; Human: 100%; Mouse: 85%; Pig: 92%; Rabbit: 85%; Rat: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CTRB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CTRB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-CTRB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)
Related Product Information for anti-CTRB1 antibody
This is a rabbit polyclonal antibody against CTRB1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Alpha-chymotrypsin (EC 3.4.21.1) is one of a family of serine proteases secreted into the gastrointestinal tract as the inactive precursor chymotrypsinogen. The zymogen is activated by proteolytic cleavage by trypsin. Alpha-chymotrypsin (EC 3.4.21.1) is one of a family of serine proteases secreted into the gastrointestinal tract as the inactive precursor chymotrypsinogen. The zymogen is activated by proteolytic cleavage by trypsin (PRSS1; MIM 276000).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-74 BX497259.1 1-74 75-652 CA946996.1 14-591 653-873 AW338596.1 1-221 c
Product Categories/Family for anti-CTRB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
chymotrypsinogen B isoform 1
NCBI Official Synonym Full Names
chymotrypsinogen B1
NCBI Official Symbol
CTRB1
NCBI Official Synonym Symbols
CTRB
NCBI Protein Information
chymotrypsinogen B
UniProt Protein Name
Chymotrypsinogen B
Protein Family
UniProt Gene Name
CTRB1

NCBI Description

This gene encodes a member of the serine protease family of enzymes and forms a principal precursor of the pancreatic proteolytic enzymes. The encoded preproprotein is synthesized in the acinar cells of the pancreas and secreted into the small intestine where it undergoes proteolytic activation to generate a functional enzyme. This gene is located adjacent to a related chymotrypsinogen gene. This gene encodes distinct isoforms, some or all of which may undergo similar processing to generate the mature protein. [provided by RefSeq, Jul 2016]

Uniprot Description

CTRB1: is one of a family of serine proteases that is secreted into the gastrointestinal tract as an inactive precursor, which is activated by proteolytic cleavage with trypsin. [provided by RefSeq, Oct 2011]

Protein type: Apoptosis; EC 3.4.21.1; Protease; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 16q23.1

Cellular Component: extracellular region

Molecular Function: serine-type endopeptidase activity; serine-type peptidase activity

Biological Process: cobalamin metabolic process; extracellular matrix disassembly

Research Articles on CTRB1

Similar Products

Product Notes

The CTRB1 ctrb1 (Catalog #AAA3201743) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CTRB1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CTRB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CTRB1 ctrb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MASLWLLSCF SLVGAAFGCG VPAIHPVLSG LSRIVNGEDA VPGSWPWQVS. It is sometimes possible for the material contained within the vial of "CTRB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.