Mouse anti-Human CTRB1 Monoclonal Antibody | anti-CTRB1 antibody

CTRB1 (Chymotrypsinogen B, CTRB) (AP)

Cat. Num. AAA6130802

• Gene Names: CTRB1; CTRB
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CTRB1; Monoclonal Antibody; CTRB1 (Chymotrypsinogen B; CTRB) (AP); anti-CTRB1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3C8
• Specificity: Recognizes human CTRB1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-CTRB1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa101-200 from human CTRB1 (NP_001897) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMIC
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged CTRB1 is 3ng/ml as a capture antibody)

Related Product Information for anti-CTRB1 antibody

CTRB1 (Chymotrypsinogen B1) is the inactive precursor of Alpha chymotrypsin, one of a family of serine proteases secreted into the gastrointestinal tract. The zymogen is activated by proteolytic cleavage by trypsin.

Product Categories/Family for anti-CTRB1 antibody

Antibodies; Proteases

NCBI and Uniprot Product Information

• NCBI GI #: 118498341
• NCBI GeneID: 1504
• NCBI Accession #: NP_001897
• NCBI GenBank Nucleotide #: NM_001906
• UniProt Accession #: P17538
• Molecular Weight: 28kDa
• NCBI Official Full Name: chymotrypsinogen B isoform 1
• NCBI Official Synonym Full Names: chymotrypsinogen B1
• NCBI Official Symbol: CTRB1
• NCBI Official Synonym Symbols: CTRB
• NCBI Protein Information: chymotrypsinogen B
• UniProt Protein Name: Chymotrypsinogen B
• Protein Family: Chymotrypsinogen
• UniProt Gene Name: CTRB1

NCBI Description

This gene encodes a member of the serine protease family of enzymes and forms a principal precursor of the pancreatic proteolytic enzymes. The encoded preproprotein is synthesized in the acinar cells of the pancreas and secreted into the small intestine where it undergoes proteolytic activation to generate a functional enzyme. This gene is located adjacent to a related chymotrypsinogen gene. This gene encodes distinct isoforms, some or all of which may undergo similar processing to generate the mature protein. [provided by RefSeq, Jul 2016]

Uniprot Description

CTRB1: is one of a family of serine proteases that is secreted into the gastrointestinal tract as an inactive precursor, which is activated by proteolytic cleavage with trypsin. [provided by RefSeq, Oct 2011]

Protein type: Apoptosis; EC 3.4.21.1; Protease; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 16q23.1

Cellular Component: extracellular region

Molecular Function: serine-type endopeptidase activity; serine-type peptidase activity

Biological Process: cobalamin metabolic process; extracellular matrix disassembly