Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type :Human Hep-2 cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit-Alexa Fluor 568Secondary Antibody Dilution :1:400Color/Signal Descriptions :Red: CTPS2 Blue: DAPIGene Name :CTPS2Submitted by :S. John Calise, Edward Chan Lab, University of Florida )

Rabbit CTPS2 Polyclonal Antibody | anti-CTPS2 antibody

CTPS2 antibody - N-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CTPS2; Polyclonal Antibody; CTPS2 antibody - N-terminal region; anti-CTPS2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AKRENFCNIHVSLVPQLSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSS
Sequence Length
586
Applicable Applications for anti-CTPS2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type :Human Hep-2 cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit-Alexa Fluor 568Secondary Antibody Dilution :1:400Color/Signal Descriptions :Red: CTPS2 Blue: DAPIGene Name :CTPS2Submitted by :S. John Calise, Edward Chan Lab, University of Florida )

Immunohistochemistry (IHC) (Sample Type :Human Hep-2 cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit-Alexa Fluor 568Secondary Antibody Dilution :1:400Color/Signal Descriptions :Red: CTPS2 Blue: DAPIGene Name :CTPS2Submitted by :S. John Calise, Edward Chan Lab, University of Florida )

Western Blot (WB)

(WB Suggested Anti-CTPS2 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellCTPS2 is supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB) (WB Suggested Anti-CTPS2 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellCTPS2 is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-CTPS2 antibody
This is a rabbit polyclonal antibody against CTPS2. It was validated on Western Blot

Target Description: The protein encoded by this gene catalyzes the formation of CTP from UTP with the concomitant deamination of glutamine to glutamate. This protein is the rate-limiting enzyme in the synthesis of cytosine nucleotides, which play an important role in various metabolic processes and provide the precursors necessary for the synthesis of RNA and DNA. Cancer cells that exhibit increased cell proliferation also exhibit an increased activity of this encoded protein. Thus, this protein is an attractive target for selective chemotherapy. Three alternatively spliced transcript variants encoding the same protein have been described for this gene.
Product Categories/Family for anti-CTPS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
CTP synthase 2
NCBI Official Synonym Full Names
CTP synthase 2
NCBI Official Symbol
CTPS2
NCBI Protein Information
CTP synthase 2
UniProt Protein Name
CTP synthase 2
Protein Family
UniProt Gene Name
CTPS2
UniProt Entry Name
PYRG2_HUMAN

NCBI Description

The protein encoded by this gene catalyzes the formation of CTP from UTP with the concomitant deamination of glutamine to glutamate. This protein is the rate-limiting enzyme in the synthesis of cytosine nucleotides, which play an important role in various metabolic processes and provide the precursors necessary for the synthesis of RNA and DNA. Cancer cells that exhibit increased cell proliferation also exhibit an increased activity of this encoded protein. Thus, this protein is an attractive target for selective chemotherapy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]

Uniprot Description

CTPS2: Catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as the source of nitrogen. Constitutes the rate-limiting enzyme in the synthesis of cytosine nucleotides. Belongs to the CTP synthase family.

Protein type: EC 6.3.4.2; Ligase; Nucleotide Metabolism - pyrimidine

Chromosomal Location of Human Ortholog: Xp22

Cellular Component: mitochondrion; cytosol

Molecular Function: CTP synthase activity; ATP binding

Biological Process: pyrimidine nucleotide metabolic process; nucleobase, nucleoside and nucleotide metabolic process; nucleobase, nucleoside and nucleotide interconversion; glutamine metabolic process

Research Articles on CTPS2

Similar Products

Product Notes

The CTPS2 ctps2 (Catalog #AAA3215628) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CTPS2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CTPS2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the CTPS2 ctps2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AKRENFCNIH VSLVPQLSAT GEQKTKPTQN SVRALRGLGL SPDLIVCRSS. It is sometimes possible for the material contained within the vial of "CTPS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.