Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-Cstf2 antibodyFormalin Fixed Paraffin Embedded Tissue: Human TestisPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Rabbit Cstf2 Polyclonal Antibody | anti-CSTF2 antibody

Cstf2 antibody - N-terminal region

Gene Names
Cstf2; Cstf64; mir-3112; C630034J23Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Cstf2; Polyclonal Antibody; Cstf2 antibody - N-terminal region; anti-CSTF2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAGLPVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYD
Sequence Length
580
Applicable Applications for anti-CSTF2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-Cstf2 antibodyFormalin Fixed Paraffin Embedded Tissue: Human TestisPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC) (Rabbit Anti-Cstf2 antibodyFormalin Fixed Paraffin Embedded Tissue: Human TestisPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Western Blot (WB)

(WB Suggested Anti-Cstf2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Pancreas)

Western Blot (WB) (WB Suggested Anti-Cstf2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Pancreas)
Related Product Information for anti-CSTF2 antibody
This is a rabbit polyclonal antibody against Cstf2. It was validated on Western Blot

Target Description: Cstf2 is one of the multiple factors required for polyadenylation and 3'-end cleavage of mammalian pre-mRNAs. This subunit is directly involved in the binding to pre-mRNAs.
Product Categories/Family for anti-CSTF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
cleavage stimulation factor subunit 2 isoform 1
NCBI Official Synonym Full Names
cleavage stimulation factor, 3' pre-RNA subunit 2
NCBI Official Symbol
Cstf2
NCBI Official Synonym Symbols
Cstf64; mir-3112; C630034J23Rik
NCBI Protein Information
cleavage stimulation factor subunit 2
UniProt Protein Name
Cleavage stimulation factor subunit 2
UniProt Gene Name
Cstf2
UniProt Synonym Gene Names
CSTF 64 kDa subunit; CstF-64

Uniprot Description

One of the multiple factors required for polyadenylation and 3'-end cleavage of mammalian pre-mRNAs. This subunit is directly involved in the binding to pre-mRNAs ().

Research Articles on CSTF2

Similar Products

Product Notes

The CSTF2 cstf2 (Catalog #AAA3205165) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cstf2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Cstf2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CSTF2 cstf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAGLPVRDPA VDRSLRSVFV GNIPYEATEE QLKDIFSEVG PVVSFRLVYD. It is sometimes possible for the material contained within the vial of "Cstf2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.