Mouse anti-Human CST5 Polyclonal Antibody | anti-CST5 antibody

CST5 (Cystatin-5, Cystatin-D)

Cat. Num. AAA6011876

• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: CST5; Polyclonal Antibody; CST5 (Cystatin-5; Cystatin-D); Anti -CST5 (Cystatin-5; anti-CST5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CST5.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MMWPMHTPLLLLTALMVAVAGSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV

• Applicable Applications for anti-CST5 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human CST5, aa1-142 (NP_001891.2).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CST5 expression in transfected 293T cell line by CST5 polyclonal antibody. Lane 1: CST5 transfected lysate (15.62kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-CST5 antibody

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. CST5 may play a protective role against proteinases present in the oral cavity.

Product Categories/Family for anti-CST5 antibody

Antibodies; Abs to Protease Inhibitors

NCBI and Uniprot Product Information

• NCBI GI #: 19882256
• NCBI GeneID: 1473
• NCBI Accession #: NP_001891.2
• NCBI GenBank Nucleotide #: NM_001900.4
• UniProt Accession #: P28325; Q5JRF5; Q9UCA0
• Molecular Weight: 16,080 Da
• NCBI Official Full Name: cystatin-D
• NCBI Official Synonym Full Names: cystatin D
• NCBI Official Symbol: CST5
• NCBI Protein Information: cystatin-D; cystatin 5; cystatin-5; cysteine-proteinase inhibitor
• UniProt Protein Name: Cystatin-D
• Protein Family: Cystatin
• UniProt Gene Name: CST5
• UniProt Entry Name: CYTD_HUMAN

NCBI Description

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a protein found in saliva and tears. The encoded protein may play a protective role against proteinases present in the oral cavity. [provided by RefSeq, Jul 2008]

Uniprot Description

CST5: Cysteine proteinase inhibitor that possibly plays a protective role against proteinases present in the oral cavity. The order of preference for inhibition is cathepsin S > cathepsin H > cathepsin L > cathepsin B. Belongs to the cystatin family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 20p11.21

Cellular Component: extracellular region

Molecular Function: protein binding; cysteine protease inhibitor activity