Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CSK2BSample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CSNK2B Polyclonal Antibody | anti-CSNK2B antibody

CSNK2B Antibody - N-terminal region

Gene Names
CSNK2B; G5A; CK2B; CK2N; Ckb1; Ckb2; CSK2B
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CSNK2B; Polyclonal Antibody; CSNK2B Antibody - N-terminal region; anti-CSNK2B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDL
Sequence Length
215
Applicable Applications for anti-CSNK2B antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CSK2B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CSK2BSample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CSK2BSample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CSNK2B antibody
This is a rabbit polyclonal antibody against CSK2B. It was validated on Western Blot

Target Description: This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
casein kinase II subunit beta isoform 1
NCBI Official Synonym Full Names
casein kinase 2 beta
NCBI Official Symbol
CSNK2B
NCBI Official Synonym Symbols
G5A; CK2B; CK2N; Ckb1; Ckb2; CSK2B
NCBI Protein Information
casein kinase II subunit beta
UniProt Protein Name
Casein kinase II subunit beta
UniProt Gene Name
CSNK2B
UniProt Synonym Gene Names
CK2N; G5A; CK II beta
UniProt Entry Name
CSK2B_HUMAN

NCBI Description

This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013]

Uniprot Description

CK2B: a regulatory subunit of the casein kinase 2 holoenzyme. Exists as a tetramer composed of two catalytic subunits, alpha and alpha-prime, and two regulatory beta subunits. The beta subunits undergo autophosphorylation. Plays a complex role in regulating the basal catalytic activity of the alpha subunit. Participates in Wnt signaling

Protein type: Protein kinase, regulatory subunit

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: cytoplasm; plasma membrane; protein kinase CK2 complex; PcG protein complex; nucleus; cytosol

Molecular Function: identical protein binding; protein serine/threonine kinase activity; protein domain specific binding; protein binding; metal ion binding; protein kinase regulator activity; transcription factor binding; receptor binding

Biological Process: negative regulation of cell proliferation; axon guidance; positive regulation of activin receptor signaling pathway; Wnt receptor signaling pathway; cellular protein complex assembly; regulation of DNA binding; adiponectin-mediated signaling pathway; mitotic cell cycle; regulation of protein kinase activity; negative regulation of blood vessel endothelial cell migration; signal transduction; protein amino acid phosphorylation

Research Articles on CSNK2B

Similar Products

Product Notes

The CSNK2B csnk2b (Catalog #AAA3220215) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CSNK2B Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CSNK2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CSNK2B csnk2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FCEVDEDYIQ DKFNLTGLNE QVPHYRQALD MILDLEPDEE LEDNPNQSDL. It is sometimes possible for the material contained within the vial of "CSNK2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.