Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged WDHD1 is 0.03 ng/ml as a capture antibody.)

Mouse WDHD1 Monoclonal Antibody | anti-WDHD1 antibody

WDHD1 (WD Repeat and HMG-Box DNA Binding Protein 1, AND-1) (Biotin)

Gene Names
WDHD1; AND1; CTF4; AND-1; CHTF4
Applications
Western Blot
Purity
Purified
Synonyms
WDHD1; Monoclonal Antibody; WDHD1 (WD Repeat and HMG-Box DNA Binding Protein 1; AND-1) (Biotin); WD Repeat and HMG-Box DNA Binding Protein 1; AND-1; anti-WDHD1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F10
Specificity
Recognizes WDHD1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-WDHD1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
WDHD1 (NP_009017, 1031aa-1128aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKGETASEGTEAKKRKRVVDESDETENQEEKAKENLNLSKKQKPLDFSTNQKLSAFAFKQ
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged WDHD1 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged WDHD1 is 0.03 ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of WDHD1 expression in transfected 293T cell line by WDHD1 monoclonal antibody (M01), clone 2F10.Lane 1: WDHD1 transfected lysate (Predicted MW: 10.89 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of WDHD1 expression in transfected 293T cell line by WDHD1 monoclonal antibody (M01), clone 2F10.Lane 1: WDHD1 transfected lysate (Predicted MW: 10.89 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB)

(WDHD1 monoclonal antibody (M01), clone 2F10. Western Blot analysis of WDHD1 expression in Hela S3 NE.)

Western Blot (WB) (WDHD1 monoclonal antibody (M01), clone 2F10. Western Blot analysis of WDHD1 expression in Hela S3 NE.)
Related Product Information for anti-WDHD1 antibody
The protein encoded by this gene contains multiple N-terminal WD40 domains and a C-terminal high mobility group (HMG) box. WD40 domains are found in a variety of eukaryotic proteins and may function as adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq]
Product Categories/Family for anti-WDHD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
126kDa
NCBI Official Full Name
WD repeat and HMG-box DNA-binding protein 1 isoform 1
NCBI Official Synonym Full Names
WD repeat and HMG-box DNA binding protein 1
NCBI Official Symbol
WDHD1
NCBI Official Synonym Symbols
AND1; CTF4; AND-1; CHTF4
NCBI Protein Information
WD repeat and HMG-box DNA-binding protein 1
UniProt Protein Name
WD repeat and HMG-box DNA-binding protein 1
UniProt Gene Name
WDHD1
UniProt Synonym Gene Names
AND1; And-1
UniProt Entry Name
WDHD1_HUMAN

NCBI Description

The protein encoded by this gene contains multiple N-terminal WD40 domains and a C-terminal high mobility group (HMG) box. WD40 domains are found in a variety of eukaryotic proteins and may function as adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

WDHD1: Acts as a replication initiation factor that brings together the MCM2-7 helicase and the DNA polymerase alpha/primase complex in order to initiate DNA replication.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 14q22.2

Cellular Component: nucleoplasm; cytoplasm; chromosome, pericentric region

Molecular Function: protein binding; DNA binding; RNA binding; chromatin binding

Biological Process: RNA processing; regulation of chromosome organization and biogenesis

Research Articles on WDHD1

Similar Products

Product Notes

The WDHD1 wdhd1 (Catalog #AAA6174657) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's WDHD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the WDHD1 wdhd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "WDHD1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.