Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemistry with Testis tissue at an antibody concentration of 5ug/ml using anti-CRY1 antibody )

Rabbit CRY1 Polyclonal Antibody | anti-CRY1 antibody

CRY1 antibody - N-terminal region

Gene Names
CRY1; DSPD; PHLL1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CRY1; Polyclonal Antibody; CRY1 antibody - N-terminal region; anti-CRY1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF
Sequence Length
586
Applicable Applications for anti-CRY1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CRY1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry with Testis tissue at an antibody concentration of 5ug/ml using anti-CRY1 antibody )

Immunohistochemistry (IHC) (Immunohistochemistry with Testis tissue at an antibody concentration of 5ug/ml using anti-CRY1 antibody )

Western Blot (WB)

(Host: RabbitTarget Name: CRY1Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CRY1Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: CRY1Sample Tissue: Human Liver TumorAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CRY1Sample Tissue: Human Liver TumorAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: CRY1Sample Type: Hela Whole cellLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/laneGel Concentration: 0.12%)

Western Blot (WB) (Host: RabbitTarget Name: CRY1Sample Type: Hela Whole cellLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/laneGel Concentration: 0.12%)
Related Product Information for anti-CRY1 antibody
This is a rabbit polyclonal antibody against CRY1. It was validated on Western Blot

Target Description: CRY1 is the blue light-dependent regulator of the circadian feedback loop. CRY1 inhibits CLOCK NPAS2-ARNTL E box-mediated transcription. CRY1 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. CRY1 has no photolyase activity. CRY1 is capable of translocating circadian clock core proteins such as PER proteins to the nucleus. CRY1 may inhibit CLOCK NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
cryptochrome-1
NCBI Official Synonym Full Names
cryptochrome circadian regulator 1
NCBI Official Symbol
CRY1
NCBI Official Synonym Symbols
DSPD; PHLL1
NCBI Protein Information
cryptochrome-1
UniProt Protein Name
Cryptochrome-1
Protein Family
UniProt Gene Name
CRY1
UniProt Synonym Gene Names
PHLL1
UniProt Entry Name
CRY1_HUMAN

NCBI Description

This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Loss of the related gene in mouse results in a shortened circadian cycle in complete darkness. [provided by RefSeq, Jan 2014]

Uniprot Description

CRY1: Blue light-dependent regulator of the circadian feedback loop. Inhibits CLOCK|NPAS2-ARNTL E box-mediated transcription. Acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. Has no photolyase activity. Capable of translocating circadian clock core proteins such as PER proteins to the nucleus. May inhibit CLOCK|NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL. Component of the circadian core oscillator, which includes the CRY proteins, CLOCK or NPAS2, ARNTL or ARNTL2, CSNK1D and/or CSNK1E, TIMELESS, and the PER proteins. Interacts directly with TIMELESS and the PER proteins. Interacts directly with PER1 and PER2 C-terminal domains. Interaction with PER2 inhibits its ubiquitination and vice versa. Binds MAPK. Interacts with FBXL21. Interacts with FBXL3. Expression is regulated by light and circadian rhythms. Peak expression in the suprachiasma nucleus (SCN) and eye at the day/night transition (CT12). Levels decrease with ARNTL-CLOCK inhibition as part of the autoregulatory feedback loop. Belongs to the DNA photolyase class-1 family.

Protein type: Lyase; DNA-binding; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 12q23-q24.1

Cellular Component: mitochondrion; nucleus

Molecular Function: ubiquitin binding; protein binding; DNA binding; DNA (6-4) photolyase activity; histone deacetylase binding; double-stranded DNA binding; nucleotide binding; deoxyribodipyrimidine photo-lyase activity; transcription factor binding; blue light photoreceptor activity; protein kinase binding; phosphatase binding; nuclear hormone receptor binding

Biological Process: circadian rhythm; response to glucagon stimulus; transcription, DNA-dependent; DNA damage induced protein phosphorylation; negative regulation of G-protein coupled receptor protein signaling pathway; negative regulation of transcription from RNA polymerase II promoter; DNA repair; regulation of circadian rhythm; glucose homeostasis; protein-chromophore linkage; response to insulin stimulus; entrainment of circadian clock by photoperiod; gluconeogenesis; blue light signaling pathway; sequestering of lipid; negative regulation of circadian rhythm; negative regulation of protein ubiquitination; circadian regulation of gene expression; negative regulation of transcription, DNA-dependent

Research Articles on CRY1

Similar Products

Product Notes

The CRY1 cry1 (Catalog #AAA3214492) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CRY1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CRY1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the CRY1 cry1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KRFQTLISKM EPLEIPVETI TSEVIEKCTT PLSDDHDEKY GVPSLEELGF. It is sometimes possible for the material contained within the vial of "CRY1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.