Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using CRIPT antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)
Rabbit anti-Mouse, Rat CRIPT Polyclonal Antibody | anti-CRIPT antibody
CRIPT Polyclonal Antibody
Gene Names
CRIPT; SSMDF; HSPC139
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
CRIPT; Polyclonal Antibody; CRIPT Polyclonal Antibody; HSPC139; SSMDF; anti-CRIPT antibody
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV
Sequence Length
101
Applicable Applications for anti-CRIPT antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human CRIPT
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell junction, Cell projection, Cytoplasm, dendritic spine, synapse
Positive Samples
Mouse lung, Rat heart
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using CRIPT antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using CRIPT antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)
Related Product Information for anti-CRIPT antibody
This gene encodes a protein that binds to the PDZ3 peptide recognition domain. The encoded protein may modulates protein interactions with the cytoskeleton. A mutation in this gene resulted in short stature with microcephaly and distinctive facies.
Product Categories/Family for anti-CRIPT antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 11kDa
Observed: 13kDa
Observed: 13kDa
NCBI Official Full Name
cysteine-rich PDZ-binding protein
NCBI Official Synonym Full Names
CXXC repeat containing interactor of PDZ3 domain
NCBI Official Symbol
CRIPT
NCBI Official Synonym Symbols
SSMDF; HSPC139
NCBI Protein Information
cysteine-rich PDZ-binding protein
UniProt Protein Name
Cysteine-rich PDZ-binding protein
Protein Family
UniProt Gene Name
CRIPT
UniProt Synonym Gene Names
Cysteine-rich interactor of PDZ3
NCBI Description
This gene encodes a protein that binds to the PDZ3 peptide recognition domain. The encoded protein may modulates protein interactions with the cytoskeleton. A mutation in this gene resulted in short stature with microcephaly and distinctive facies. [provided by RefSeq, Jun 2014]
Uniprot Description
Involved in the cytoskeletal anchoring of DLG4 in excitatory synapses.
Research Articles on CRIPT
Similar Products
Product Notes
The CRIPT cript (Catalog #AAA9134341) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CRIPT Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CRIPT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the CRIPT cript for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVCEKCEKKL GTVITPDTWK DGARNTTESG GRKLNENKAL TSKKARFDPY GKNKFSTCRI CKSSVHQPGS HYCQGCAYKK GICAMCGKKV LDTKNYKQTS V. It is sometimes possible for the material contained within the vial of "CRIPT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
