Western Blot (WB)
(Western blot analysis of extracts of HeLa cells, using TMEM70 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Rabbit anti-Human, Mouse TMEM70 Polyclonal Antibody | anti-TMEM70 antibody
TMEM70 Polyclonal Antibody
Gene Names
TMEM70; MC5DN2
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
TMEM70; Polyclonal Antibody; TMEM70 Polyclonal Antibody; MC5DN2; anti-TMEM70 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
FITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVKIPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDK
Sequence Length
107
Applicable Applications for anti-TMEM70 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human TMEM70
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Mitochondrion inner membrane, Multi-pass membrane protein
Positive Samples
HeLa
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of HeLa cells, using TMEM70 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of HeLa cells, using TMEM70 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-TMEM70 antibody
This gene likely encodes a mitochondrial membrane protein. The encoded protein may play a role in biogenesis of mitochondrial ATP synthase. Mutations in this gene have been associated with neonatal mitochondrial encephalocardiomyopathy due to ATP synthase deficiency. Alternatively spliced transcript variants have been described.
Product Categories/Family for anti-TMEM70 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 11kDa; 18kDa; 28kDa
Observed: 18kDa
Observed: 18kDa
NCBI Official Full Name
transmembrane protein 70, mitochondrial isoform b
NCBI Official Synonym Full Names
transmembrane protein 70
NCBI Official Symbol
TMEM70
NCBI Official Synonym Symbols
MC5DN2
NCBI Protein Information
transmembrane protein 70, mitochondrial
UniProt Protein Name
Transmembrane protein 70, mitochondrial
Protein Family
UniProt Gene Name
TMEM70
NCBI Description
This gene likely encodes a mitochondrial membrane protein. The encoded protein may play a role in biogenesis of mitochondrial ATP synthase. Mutations in this gene have been associated with neonatal mitochondrial encephalocardiomyopathy due to ATP synthase deficiency. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2010]
Uniprot Description
Involved in biogenesis of mitochondrial ATP synthase.
Research Articles on TMEM70
Similar Products
Product Notes
The TMEM70 tmem70 (Catalog #AAA9133739) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEM70 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM70 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the TMEM70 tmem70 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FITKGYVIRL YHEATTDTYK AITYNAMLAE TSTVFHQNDV KIPDAKHVFT TFYAKTKSLL VNPVLFPNRE DYIHLMGYDK EEFILYMEET SEEKRHKDDK. It is sometimes possible for the material contained within the vial of "TMEM70, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
