Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CRADDSample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CRADD Polyclonal Antibody | anti-CRADD antibody

CRADD Antibody - middle region

Gene Names
CRADD; MRT34; RAIDD
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CRADD; Polyclonal Antibody; CRADD Antibody - middle region; anti-CRADD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYR
Sequence Length
199
Applicable Applications for anti-CRADD antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human CRADD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CRADDSample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CRADDSample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CRADD antibody
This is a rabbit polyclonal antibody against CRADD. It was validated on Western Blot

Target Description: The protein encoded by this gene is a death domain (CARD/DD)-containing protein and has been shown to induce cell apoptosis. Through its CARD domain, this protein interacts with, and thus recruits, caspase 2/ICH1 to the cell death signal transduction complex that includes tumor necrosis factor receptor 1 (TNFR1A), RIPK1/RIP kinase, and numbers of other CARD domain-containing proteins.
Product Categories/Family for anti-CRADD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
death domain-containing protein CRADD isoform 1
NCBI Official Synonym Full Names
CASP2 and RIPK1 domain containing adaptor with death domain
NCBI Official Symbol
CRADD
NCBI Official Synonym Symbols
MRT34; RAIDD
NCBI Protein Information
death domain-containing protein CRADD
UniProt Protein Name
Death domain-containing protein CRADD
UniProt Gene Name
CRADD
UniProt Synonym Gene Names
RAIDD
UniProt Entry Name
CRADD_HUMAN

NCBI Description

This gene encodes a protein containing a death domain (DD) motif. This protein recruits caspase 2/ICH1 to the cell death signal transduction complex, which includes tumor necrosis factor receptor 1 (TNFR1A) and RIPK1/RIP kinase, and acts in promoting apoptosis. A mutation in this gene was associated with cognitive disability. A related pseudogene is found on chromosome 3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]

Uniprot Description

CRADD: Apoptotic adaptor molecule specific for caspase-2 and FASL/TNF receptor-interacting protein RIP. In the presence of RIP and TRADD, CRADD recruits caspase-2 to the TNFR-1 signalling complex. Defects in CRADD are the cause of mental retardation autosomal recessive type 34 (MRT34). A disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. MRT34 is a non- syndromic form. Affected individuals have mildly delayed development and significantly impaired cognitive function, precluding independent living and self-care. Speech is rudimentary, but articulate; autism is not present.

Protein type: Adaptor/scaffold; Apoptosis

Chromosomal Location of Human Ortholog: 12q21.33-q23.1

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding, bridging; protein binding; protease binding

Biological Process: caspase activation; induction of apoptosis via death domain receptors; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest

Disease: Mental Retardation, Autosomal Recessive 34

Research Articles on CRADD

Similar Products

Product Notes

The CRADD cradd (Catalog #AAA3219242) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CRADD Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CRADD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CRADD cradd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PAGDRLTGIP SHILNSSPSD RQINQLAQRL GPEWEPMVLS LGLSQTDIYR. It is sometimes possible for the material contained within the vial of "CRADD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.