Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CPVLSample Type: Fetal Liver lysatesAntibody Dilution: 1ug/ml)

Rabbit CPVL Polyclonal Antibody | anti-CPVL antibody

CPVL Antibody - C-terminal region

Gene Names
CPVL; HVLP
Reactivity
Cow, Horse, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CPVL; Polyclonal Antibody; CPVL Antibody - C-terminal region; anti-CPVL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MGMDWKGSQEYKKAEKKVWKIFKSDSEVAGYIRQAGDFHQVIIRGGGHIL
Sequence Length
476
Applicable Applications for anti-CPVL antibody
Western Blot (WB)
Homology
Cow: 86%; Horse: 86%; Human: 100%; Rabbit: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CPVL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CPVLSample Type: Fetal Liver lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CPVLSample Type: Fetal Liver lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CPVL antibody
This is a rabbit polyclonal antibody against CPVL. It was validated on Western Blot

Target Description: The protein encoded by this gene is a carboxypeptidase and bears strong sequence similarity to serine carboxypeptidases. Carboxypeptidases are a large class of proteases that act to cleave a single amino acid from the carboxy termini of proteins or peptides. The exact function of this protein, however, has not been determined. At least two alternatively spliced transcripts which encode the same protein have been observed.
Product Categories/Family for anti-CPVL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Synonym Full Names
carboxypeptidase vitellogenic like
NCBI Official Symbol
CPVL
NCBI Official Synonym Symbols
HVLP
NCBI Protein Information
probable serine carboxypeptidase CPVL
UniProt Protein Name
Probable serine carboxypeptidase CPVL
UniProt Gene Name
CPVL
UniProt Synonym Gene Names
VLP; VCP-like protein; hVLP
UniProt Entry Name
CPVL_HUMAN

NCBI Description

The protein encoded by this gene is a carboxypeptidase and bears strong sequence similarity to serine carboxypeptidases. Carboxypeptidases are a large class of proteases that act to cleave a single amino acid from the carboxy termini of proteins or peptides. The exact function of this protein, however, has not been determined. [provided by RefSeq, Jan 2017]

Uniprot Description

CPVL: May be involved in the digestion of phagocytosed particles in the lysosome, participation in an inflammatory protease cascade, and trimming of peptides for antigen presentation. Belongs to the peptidase S10 family.

Protein type: Secreted, signal peptide; Protease; EC 3.4.16.-; Secreted

Chromosomal Location of Human Ortholog: 7p15.1

Molecular Function: serine carboxypeptidase activity

Biological Process: proteolysis

Research Articles on CPVL

Similar Products

Product Notes

The CPVL cpvl (Catalog #AAA3215336) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CPVL Antibody - C-terminal region reacts with Cow, Horse, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's CPVL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CPVL cpvl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MGMDWKGSQE YKKAEKKVWK IFKSDSEVAG YIRQAGDFHQ VIIRGGGHIL. It is sometimes possible for the material contained within the vial of "CPVL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.