Western Blot (WB)
(WB Suggested Anti-CPSF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)
Rabbit CPSF1 Polyclonal Antibody | anti-CPSF1 antibody
CPSF1 antibody - middle region
Gene Names
CPSF1; CPSF160; P/cl.18; HSU37012
Reactivity
Horse, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CPSF1; Polyclonal Antibody; CPSF1 antibody - middle region; anti-CPSF1 antibody
Host
Rabbit
Reactivity
Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GCYDMWTVIAPVRKEEEDNPKGEGTEQEPSTTPEADDDGRRHGFLILSRE
Sequence Length
1443
Applicable Applications for anti-CPSF1 antibody
Western Blot (WB)
Homology
Horse: 79%; Human: 100%; Rat: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CPSF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-CPSF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)
Western Blot (WB)
(WB Suggested Anti-CPSF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)
Related Product Information for anti-CPSF1 antibody
This is a rabbit polyclonal antibody against CPSF1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: CPSF1 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex that plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. This subunit is involved in the RNA recognition step of the polyadenylation reaction.
Target Description: CPSF1 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex that plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. This subunit is involved in the RNA recognition step of the polyadenylation reaction.
Product Categories/Family for anti-CPSF1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
161kDa
NCBI Official Full Name
cleavage and polyadenylation specificity factor subunit 1
NCBI Official Synonym Full Names
cleavage and polyadenylation specific factor 1
NCBI Official Symbol
CPSF1
NCBI Official Synonym Symbols
CPSF160; P/cl.18; HSU37012
NCBI Protein Information
cleavage and polyadenylation specificity factor subunit 1
UniProt Protein Name
Cleavage and polyadenylation specificity factor subunit 1
UniProt Gene Name
CPSF1
UniProt Synonym Gene Names
CPSF160; CPSF 160 kDa subunit
NCBI Description
Cleavage and polyadenylation specificity factor (CPSF) is a multisubunit complex that plays a central role in 3-prime processing of pre-mRNAs. CPSF recognizes the AAUAAA signal in the pre-mRNA and interacts with other proteins to facilitate both RNA cleavage and poly(A) synthesis. CPSF1 is the largest subunit of the CPSF complex (Murthy and Manley, 1995 [PubMed 7590244]).[supplied by OMIM, Mar 2008]
Uniprot Description
Component of the cleavage and polyadenylation specificity factor (CPSF) complex that plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. This subunit is involved in the RNA recognition step of the polyadenylation reaction.
Research Articles on CPSF1
Similar Products
Product Notes
The CPSF1 cpsf1 (Catalog #AAA3205444) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CPSF1 antibody - middle region reacts with Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CPSF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CPSF1 cpsf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GCYDMWTVIA PVRKEEEDNP KGEGTEQEPS TTPEADDDGR RHGFLILSRE. It is sometimes possible for the material contained within the vial of "CPSF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
