Western Blot (WB)
(WB Suggested Anti-CPSF2 Antibody Titration: 0.2-1 ug/mlPositive Control: Human heart)
Rabbit CPSF2 Polyclonal Antibody | anti-CPSF2 antibody
CPSF2 antibody - N-terminal region
Gene Names
CPSF2; CPSF100
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CPSF2; Polyclonal Antibody; CPSF2 antibody - N-terminal region; anti-CPSF2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YAVGKLGLNCAIYATIPVYKMGQMFMYDLYQSRHNTEDFTLFTLDDVDAA
Sequence Length
782
Applicable Applications for anti-CPSF2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CPSF2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-CPSF2 Antibody Titration: 0.2-1 ug/mlPositive Control: Human heart)
Western Blot (WB)
(WB Suggested Anti-CPSF2 Antibody Titration: 0.2-1 ug/mlPositive Control: Human heart)
Related Product Information for anti-CPSF2 antibody
This is a rabbit polyclonal antibody against CPSF2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: CPSF2 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. It belongs to the metallo-beta-lactamase superfamily, RNA-metabolizing metallo-beta-lactamase-like family, CPSF2/YSH1 subfamily.
Target Description: CPSF2 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. It belongs to the metallo-beta-lactamase superfamily, RNA-metabolizing metallo-beta-lactamase-like family, CPSF2/YSH1 subfamily.
Product Categories/Family for anti-CPSF2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88kDa
NCBI Official Full Name
cleavage and polyadenylation specificity factor subunit 2 isoform 1
NCBI Official Synonym Full Names
cleavage and polyadenylation specific factor 2
NCBI Official Symbol
CPSF2
NCBI Official Synonym Symbols
CPSF100
NCBI Protein Information
cleavage and polyadenylation specificity factor subunit 2
UniProt Protein Name
Cleavage and polyadenylation specificity factor subunit 2
UniProt Gene Name
CPSF2
UniProt Synonym Gene Names
CPSF100; KIAA1367; CPSF 100 kDa subunit
UniProt Entry Name
CPSF2_HUMAN
Research Articles on CPSF2
Similar Products
Product Notes
The CPSF2 cpsf2 (Catalog #AAA3205511) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CPSF2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CPSF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CPSF2 cpsf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YAVGKLGLNC AIYATIPVYK MGQMFMYDLY QSRHNTEDFT LFTLDDVDAA. It is sometimes possible for the material contained within the vial of "CPSF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
