Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of CPM expression in HEPG2 whole cell lysates (lane 1). CPM at 65KD was detected using rabbit anti- CPM Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit anti-Human CPM Polyclonal Antibody | anti-CPM antibody

Anti-CPM Antibody

Reactivity
Human
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
CPM; Polyclonal Antibody; Anti-CPM Antibody; Carboxypeptidase M; Renal carboxypeptidase; Urinary carboxypeptidase B; P14384; anti-CPM antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
443
Applicable Applications for anti-CPM antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human CPM (286-316aa KYPREEKLPSFWNNNKASLIEYIKQVHLGVK), different from the related mouse sequence by two amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of CPM expression in HEPG2 whole cell lysates (lane 1). CPM at 65KD was detected using rabbit anti- CPM Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of CPM expression in HEPG2 whole cell lysates (lane 1). CPM at 65KD was detected using rabbit anti- CPM Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-CPM antibody
Rabbit IgG polyclonal antibody for Carboxypeptidase M(CPM) detection.
Background: CPM, mapped to 12q15, is known as Carboxypeptidase M. The protein encoded by this gene is a membrane-bound arginine/lysine carboxypeptidase. Its expression is associated with monocyte to macrophage differentiation. This encoded protein contains hydrophobic regions at the amino and carboxy termini and has 6 potential asparagine-linked glycosylation sites. The active site residues of carboxypeptidases A and B are conserved in this protein. Three alternatively spliced transcript variants encoding the same protein have been described for this gene.
References
1. Kas, K., Schoenmakers, E. F. P. M., Van de Ven, W. J. M. Physical map location of the human carboxypeptidase M gene (CPM) distal to D12S375 and proximal to D12S8 at chromosome 12q15. Genomics 30: 403-405, 1995.
2. Rehli, M., Krause, S. W., Kreutz, M., Andreesen, R. Carboxypeptidase M is identical to the MAX.1 antigen and its expression is associated with monocyte to macrophage differentiation. J. Biol. Chem. 270: 15644-15649, 1995.
3. Tan, F., Chan, S. J., Steiner, D. F., Schilling, J. W., Skidgel, R. A. Molecular cloning and sequencing of the cDNA for human membrane-bound carboxypeptidase M: comparison with carboxypeptidases A, B, H, and N. J. Biol. Chem. 264: 13165-13170, 1989.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,514 Da
NCBI Official Full Name
carboxypeptidase M
NCBI Official Synonym Full Names
carboxypeptidase M
NCBI Official Symbol
CPM
NCBI Protein Information
carboxypeptidase M
UniProt Protein Name
Carboxypeptidase M
Protein Family
UniProt Gene Name
CPM
UniProt Synonym Gene Names
CPM

NCBI Description

The protein encoded by this gene is a membrane-bound arginine/lysine carboxypeptidase. Its expression is associated with monocyte to macrophage differentiation. This encoded protein contains hydrophobic regions at the amino and carboxy termini and has 6 potential asparagine-linked glycosylation sites. The active site residues of carboxypeptidases A and B are conserved in this protein. Three alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CPM: Specifically removes C-terminal basic residues (Arg or Lys) from peptides and proteins. It is believed to play important roles in the control of peptide hormone and growth factor activity at the cell surface, and in the membrane-localized degradation of extracellular proteins. Belongs to the peptidase M14 family.

Protein type: EC 3.4.17.12; Membrane protein, GPI anchor; Protease

Chromosomal Location of Human Ortholog: 12q15

Cellular Component: cell surface; extracellular space

Molecular Function: carboxypeptidase activity; serine carboxypeptidase activity

Biological Process: anatomical structure morphogenesis; peptide metabolic process; protein processing

Research Articles on CPM

Similar Products

Product Notes

The CPM cpm (Catalog #AAA178652) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-CPM Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CPM can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the CPM cpm for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CPM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.