Western Blot (WB)
(WB Suggested Anti-Arntl2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Heart)
Rabbit Arntl2 Polyclonal Antibody | anti-ARNTL2 antibody
Arntl2 antibody - C-terminal region
Gene Names
Arntl2; CLIF; MOP9; BMAL2; bHLHe6; 4632430A05Rik
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Arntl2; Polyclonal Antibody; Arntl2 antibody - C-terminal region; anti-ARNTL2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AILGYLPQELLGTSCYEYFHQDDHSSLTDKHKAVLQSKEKILTDSYKFRV
Sequence Length
579
Applicable Applications for anti-ARNTL2 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 92%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 83%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Arntl2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Heart)
Western Blot (WB)
(WB Suggested Anti-Arntl2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Heart)
Related Product Information for anti-ARNTL2 antibody
This is a rabbit polyclonal antibody against Arntl2. It was validated on Western Blot
Target Description: ARNTL2/CLOCK heterodimers activate E-box element (3'-CACGTG-5') transcription. Also, in umbilical vein endothelial cells, Arntl2 activates SERPINE1 through E-box sites. This transactivation is inhibited by PER2 and CRY1.
Target Description: ARNTL2/CLOCK heterodimers activate E-box element (3'-CACGTG-5') transcription. Also, in umbilical vein endothelial cells, Arntl2 activates SERPINE1 through E-box sites. This transactivation is inhibited by PER2 and CRY1.
Product Categories/Family for anti-ARNTL2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
aryl hydrocarbon receptor nuclear translocator-like protein 2 isoform 1
NCBI Official Synonym Full Names
aryl hydrocarbon receptor nuclear translocator-like 2
NCBI Official Symbol
Arntl2
NCBI Official Synonym Symbols
CLIF; MOP9; BMAL2; bHLHe6; 4632430A05Rik
NCBI Protein Information
aryl hydrocarbon receptor nuclear translocator-like protein 2
UniProt Protein Name
Aryl hydrocarbon receptor nuclear translocator-like protein 2
Protein Family
UniProt Gene Name
Arntl2
UniProt Synonym Gene Names
Bmal2
UniProt Entry Name
BMAL2_MOUSE
NCBI Description
This gene encodes a basic helix-loop-helix transcription factor belonging to the PAS (Per, Arnt, Sim) superfamily. The PAS proteins play important roles in adaptation to low atmospheric and cellular oxygen levels, exposure to certain environmental pollutants, and diurnal oscillations in light and temperature. This protein forms a transcriptionally active heterodimer with the circadian Clock protein, the structurally related Mop4, and hypoxia-inducible factors, such as Hif1alpha. Consistent with its role as a biologically relevant partner of circadian and hypoxia factors, this protein is coexpressed in regions of the brain such as the thalamus, hypothalamus, and amygdala. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Feb 2014]
Research Articles on ARNTL2
Similar Products
Product Notes
The ARNTL2 arntl2 (Catalog #AAA3201241) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Arntl2 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Arntl2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARNTL2 arntl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AILGYLPQEL LGTSCYEYFH QDDHSSLTDK HKAVLQSKEK ILTDSYKFRV. It is sometimes possible for the material contained within the vial of "Arntl2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
