Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB)

Rabbit COVID 19 ORF8 Coronavirus Polyclonal Antibody | anti-COVID-19 antibody

Anti SARS-CoV-2 (2019-nCoV) ORF8 protein polyclonal antibody

Reactivity
Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Applications
ELISA
Synonyms
COVID 19 ORF8 Coronavirus; Polyclonal Antibody; Anti SARS-CoV-2 (2019-nCoV) ORF8 protein polyclonal antibody; 2019 Novel Coronavirus; Coronavirus; CoV; COVID-19 virus; HCoV-2; Human Coronavirus 2019; SARS2; SARS-CoV-2; Severe acute respiratory syndrome coronavirus 2; ORF8; anti-COVID-19 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes SARS-CoV-2 ORF8 protein
Form/Format
Liquid. PBS, pH7.4, containing 0.05% proclin300, 50% glycerol
Concentration
0.43mg/ml (varies by lot)
Applicable Applications for anti-COVID-19 antibody
Elisa (EIA)
Application Notes
Elisa: 1:4000~1:8000
Immunogen
MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
Conjugation
Unconjugate
Preparation and Storage
Use a manual defrost freezer and avoid repeated freeze thaw cycles. Store at 2 to 8 degree C for one week. Store at -20 to -99 degree C for ~12 months from the date of receipt

Western Blot (WB)

Western Blot (WB)
Related Product Information for anti-COVID-19 antibody
Produced in rabbits immunized with purified, Recombinant SARS-CoV-2 ORF8 protein
May play a role in host-virus interaction.
Product Categories/Family for anti-COVID-19 antibody

NCBI and Uniprot Product Information

UniProt Accession #
Molecular Weight
MW: 13kDa

Similar Products

Product Notes

The COVID-19 (Catalog #AAA1560400) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti SARS-CoV-2 (2019-nCoV) ORF8 protein polyclonal antibody reacts with Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) and may cross-react with other species as described in the data sheet. AAA Biotech's COVID 19 ORF8 Coronavirus can be used in a range of immunoassay formats including, but not limited to, Elisa (EIA). Elisa: 1:4000~1:8000. Researchers should empirically determine the suitability of the COVID-19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "COVID 19 ORF8 Coronavirus, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.