Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: COQ3Sample Tissue: Human Thymus Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human COQ3 Polyclonal Antibody | anti-COQ3 antibody

COQ3 Antibody - middle region

Gene Names
COQ3; DHHBMT; bA9819.1; DHHBMTASE; UG0215E05
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
COQ3; Polyclonal Antibody; COQ3 Antibody - middle region; anti-COQ3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YALGIVFSEQIASIVPKGTHTWEKFVSPETLESILESNGLSVQTVVGMLY
Sequence Length
369
Applicable Applications for anti-COQ3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human COQ3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: COQ3Sample Tissue: Human Thymus Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: COQ3Sample Tissue: Human Thymus Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-COQ3 antibody
Ubiquinone, also known as coenzyme Q, or Q, is a critical component of the electron transport pathways of both eukaryotes and prokaryotes. This lipid consists of a hydrophobic isoprenoid tail and a quinone head group. The tail varies in length depending on the organism, but its purpose is to anchor coenzyme Q to the membrane. The quinone head group is responsible for the activity of coenzyme Q in the respiratory chain. The S. cerevisiae COQ3 gene encodes an O-methyltransferase required for 2 steps in the biosynthetic pathway of coenzyme Q. This enzyme methylates an early coenzyme Q intermediate, 3,4-dihydroxy-5-polyprenylbenzoic acid, as well as the final intermediate in the pathway, converting demethyl-ubiquinone to coenzyme Q. The COQ3 gene product is also capable of methylating the distinct prokaryotic early intermediate 2-hydroxy-6-polyprenyl phenol.
Product Categories/Family for anti-COQ3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40 kDa
NCBI Official Full Name
ubiquinone biosynthesis O-methyltransferase, mitochondrial
NCBI Official Synonym Full Names
coenzyme Q3, methyltransferase
NCBI Official Symbol
COQ3
NCBI Official Synonym Symbols
DHHBMT; bA9819.1; DHHBMTASE; UG0215E05
NCBI Protein Information
ubiquinone biosynthesis O-methyltransferase, mitochondrial
UniProt Protein Name
Hexaprenyldihydroxybenzoate methyltransferase, mitochondrial
UniProt Gene Name
COQ3
UniProt Synonym Gene Names
DHHB methyltransferase; DHHB-MT; DHHB-MTase
UniProt Entry Name
COQ3_HUMAN

NCBI Description

Ubiquinone, also known as coenzyme Q, or Q, is a critical component of the electron transport pathways of both eukaryotes and prokaryotes (Jonassen and Clarke, 2000 [PubMed 10777520]). This lipid consists of a hydrophobic isoprenoid tail and a quinone head group. The tail varies in length depending on the organism, but its purpose is to anchor coenzyme Q to the membrane. The quinone head group is responsible for the activity of coenzyme Q in the respiratory chain. The S. cerevisiae COQ3 gene encodes an O-methyltransferase required for 2 steps in the biosynthetic pathway of coenzyme Q. This enzyme methylates an early coenzyme Q intermediate, 3,4-dihydroxy-5-polyprenylbenzoic acid, as well as the final intermediate in the pathway, converting demethyl-ubiquinone to coenzyme Q. The COQ3 gene product is also capable of methylating the distinct prokaryotic early intermediate 2-hydroxy-6-polyprenyl phenol.[supplied by OMIM, Mar 2008]

Uniprot Description

Catalytic activity: S-adenosyl-L-methionine + 3,4-dihydroxy-5-all-trans-polyprenylbenzoate = S-adenosyl-L-homocysteine + 3-methoxy-4-hydroxy-5-all-trans-polyprenylbenzoate. Ref.6S-adenosyl-L-methionine + 3-demethylubiquinone-n = S-adenosyl-L-homocysteine + ubiquinone-n. Ref.6S-adenosyl-L-methionine + 3-(all-trans-polyprenyl)benzene-1,2-diol = S-adenosyl-L-homocysteine + 2-methoxy-6-(all-trans-polyprenyl)phenol. Ref.6

Pathway: Cofactor biosynthesis; ubiquinone biosynthesis.

Subcellular location: Mitochondrion matrix

Probable.

Sequence similarities: Belongs to the methyltransferase superfamily. UbiG/COQ3 family.

Sequence caution: The sequence AAF66826.1 differs from that shown. Reason: Frameshift at positions 16, 18, 22, 26, 44, 49, 60, 363 and 364.

Research Articles on COQ3

Similar Products

Product Notes

The COQ3 coq3 (Catalog #AAA3222756) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COQ3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's COQ3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the COQ3 coq3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YALGIVFSEQ IASIVPKGTH TWEKFVSPET LESILESNGL SVQTVVGMLY. It is sometimes possible for the material contained within the vial of "COQ3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.