Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Jagged 2 antibody (MBS839305) used at 1 ug/ml to detect target protein.)

Rabbit Jagged 2 Polyclonal Antibody | anti-JAG2 antibody

Jagged 2 antibody

Gene Names
JAG2; HJ2; SER2
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
Jagged 2; Polyclonal Antibody; Jagged 2 antibody; Polyclonal Jagged 2; Anti-Jagged 2; JAG2; HJ2; anti-JAG2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
Jagged 2 antibody was raised against the N terminal of JAG2
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of JAG2 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
126
Applicable Applications for anti-JAG2 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch protein family are transmembrane receptors that are critical for various cell fate decisions. JAG2 is one of several ligands that activate Notch and related receptors. The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
Jagged 2 antibody was raised using the N terminal of JAG2 corresponding to a region with amino acids RAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCD
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Jagged 2 antibody (MBS839305) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Jagged 2 antibody (MBS839305) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-JAG2 antibody
Rabbit polyclonal Jagged 2 antibody raised against the N terminal of JAG2
Product Categories/Family for anti-JAG2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
130 kDa (MW of target protein)
NCBI Official Full Name
Jagged 2, partial
NCBI Official Synonym Full Names
jagged 2
NCBI Official Symbol
JAG2
NCBI Official Synonym Symbols
HJ2; SER2
NCBI Protein Information
protein jagged-2
UniProt Protein Name
Protein jagged-2
Protein Family
UniProt Gene Name
JAG2
UniProt Synonym Gene Names
Jagged2; hJ2
UniProt Entry Name
JAG2_HUMAN

NCBI Description

The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions. The protein encoded by this gene is one of several ligands that activate Notch and related receptors. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

JAG2: Putative Notch ligand involved in the mediation of Notch signaling. Involved in limb development. Expressed in heart, placenta and skeletal muscle and to a lesser extend in pancreas. Very low expression in brain, lung, liver and kidney. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell surface; Membrane protein, integral

Chromosomal Location of Human Ortholog: 14q32

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: protein binding; growth factor activity; calcium ion binding; Notch binding

Biological Process: regulation of cell adhesion; thymic T cell selection; Notch signaling pathway; in utero embryonic development; Notch receptor processing; cell cycle; regulation of cell migration; regulation of cell proliferation; odontogenesis of dentine-containing teeth; respiratory system process; morphogenesis of embryonic epithelium; spermatogenesis; auditory receptor cell fate commitment; cell differentiation; skeletal development; T cell differentiation; gamma-delta T cell differentiation

Research Articles on JAG2

Similar Products

Product Notes

The JAG2 jag2 (Catalog #AAA839305) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Jagged 2 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Jagged 2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the JAG2 jag2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Jagged 2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.