Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Complement C4b antibody (MBS839274) used at 1 ug/ml to detect target protein.)

Rabbit Complement C4b Polyclonal Antibody | anti-C4B antibody

Complement C4b antibody

Gene Names
C4B; CH; C4F; CO4; C4B1; C4B2; C4B3; C4B5; C4BD; C4B12; C4B_2; CPAMD3
Applications
Western Blot
Purity
Affinity purified
Synonyms
Complement C4b; Polyclonal Antibody; Complement C4b antibody; Polyclonal Complement C4b; Anti-Complement C4b; C4B5; Complement Cb-4; Complement Cb 4; MGC164979; CH; C4B1; C4B; C4B3; C4B12; C4F; CPAMD3; C4A91; CO4; C4A13; C4B2; C4A; anti-C4B antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C4B antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
1744
Applicable Applications for anti-C4B antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
C4B is the basic form of complement factor 4, part of the classical activation pathway. The protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain may be cleaved to release C4 anaphylatoxin, a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus. This gene encodes the basic form of complement factor 4, part of the classical activation pathway.
Cross-Reactivity
Human
Immunogen
Complement C4b antibody was raised using a synthetic peptide corresponding to a region with amino acids QTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYM
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Complement C4b antibody (MBS839274) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Complement C4b antibody (MBS839274) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-C4B antibody
Rabbit polyclonal Complement C4b antibody
Product Categories/Family for anti-C4B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
721
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33 kDa (MW of target protein)
NCBI Official Full Name
complement C4-B preproprotein
NCBI Official Synonym Full Names
complement component 4B (Chido blood group)
NCBI Official Symbol
C4B
NCBI Official Synonym Symbols
CH; C4F; CO4; C4B1; C4B2; C4B3; C4B5; C4BD; C4B12; C4B_2; CPAMD3
NCBI Protein Information
complement C4-B
UniProt Protein Name
Complement C4-B
Protein Family
UniProt Gene Name
C4B
UniProt Synonym Gene Names
CO4; CPAMD3
UniProt Entry Name
CO4B_HUMAN

NCBI Description

This gene encodes the basic form of complement factor 4, part of the classical activation pathway. The protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain may be cleaved to release C4 anaphylatoxin, a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. Varying haplotypes of this gene cluster exist, such that individuals may have 1, 2, or 3 copies of this gene. In addition, this gene exists as a long form and a short form due to the presence or absence of a 6.4 kb endogenous HERV-K retrovirus in intron 9. [provided by RefSeq, Jul 2008]

Uniprot Description

C4B: C4 plays a central role in the activation of the classical pathway of the complement system. It is processed by activated C1 which removes from the alpha chain the C4a anaphylatoxin. The remaining alpha chain fragment C4b is the major activation product and is an essential subunit of the C3 convertase (C4b2a) and the C5 convertase (C3bC4b2a) enzymes of the classical complement pathway. Defects in C4B are a cause of susceptibility to systemic lupus erythematosus (SLE). A chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system. Interindividual copy- number variation (CNV) of complement component C4 and associated polymorphisms result in different susceptibilities to SLE. The risk of SLE susceptibility has been shown to be significantly increased among subjects with only two copies of total C4. A high copy number is a protective factor against SLE. Defects in C4B are the cause of complement component 4B deficiency (C4BD). A rare defect of the complement classical pathway associated with the development of autoimmune disorders, mainly systemic lupus with or without associated glomerulonephritis.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: extracellular space; extracellular region; plasma membrane

Molecular Function: complement binding; endopeptidase inhibitor activity; carbohydrate binding

Biological Process: detection of molecule of bacterial origin; regulation of complement activation; innate immune response; opsonization; inflammatory response; complement activation, classical pathway; complement activation

Disease: Complement Component 4b Deficiency

Research Articles on C4B

Similar Products

Product Notes

The C4B c4b (Catalog #AAA839274) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Complement C4b can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the C4B c4b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Complement C4b, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.