Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ZFPM2Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ZFPM2 Polyclonal Antibody | anti-ZFPM2 antibody

ZFPM2 Antibody - C-terminal region

Gene Names
ZFPM2; DIH3; FOG2; SRXY9; ZNF89B; hFOG-2; ZC2HC11B
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ZFPM2; Polyclonal Antibody; ZFPM2 Antibody - C-terminal region; anti-ZFPM2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QENISQNPQHEDDHKSPSWISENPLAANENVSPGIPSAEEQLSSIAKGVN
Sequence Length
1019
Applicable Applications for anti-ZFPM2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ZFPM2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ZFPM2Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ZFPM2Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ZFPM2 antibody
The zinc finger protein encoded by this gene is a widely expressed member of the FOG family of transcription factors. The family members modulate the activity of GATA family proteins, which are important regulators of hematopoiesis and cardiogenesis in mammals. It has been demonstrated that the protein can both activate and down-regulate expression of GATA-target genes, suggesting different modulation in different promoter contexts. A related mRNA suggests an alternatively spliced product but this information is not yet fully supported by the sequence.
Product Categories/Family for anti-ZFPM2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
112 kDa
NCBI Official Full Name
zinc finger protein ZFPM2 isoform 1
NCBI Official Synonym Full Names
zinc finger protein, FOG family member 2
NCBI Official Symbol
ZFPM2
NCBI Official Synonym Symbols
DIH3; FOG2; SRXY9; ZNF89B; hFOG-2; ZC2HC11B
NCBI Protein Information
zinc finger protein ZFPM2
UniProt Protein Name
Zinc finger protein ZFPM2
Protein Family
UniProt Gene Name
ZFPM2
UniProt Synonym Gene Names
FOG2; ZNF89B; FOG-2; Friend of GATA 2; hFOG-2
UniProt Entry Name
FOG2_HUMAN

NCBI Description

The zinc finger protein encoded by this gene is a widely expressed member of the FOG family of transcription factors. The family members modulate the activity of GATA family proteins, which are important regulators of hematopoiesis and cardiogenesis in mammals. It has been demonstrated that the protein can both activate and down-regulate expression of GATA-target genes, suggesting different modulation in different promoter contexts. A related mRNA suggests an alternatively spliced product but this information is not yet fully supported by the sequence. [provided by RefSeq, Jul 2008]

Uniprot Description

FOG2: Transcription regulator that plays a central role in heart morphogenesis and development of coronary vessels from epicardium, by regulating genes that are essential during cardiogenesis. Essential cofactor that acts via the formation of a heterodimer with transcription factors of the GATA family GATA4, GATA5 and GATA6. Such heterodimer can both activate or repress transcriptional activity, depending on the cell and promoter context. Also required in gonadal differentiation, possibly be regulating expression of SRY. Probably acts a corepressor of NR2F2. Defects in ZFPM2 may be a cause of tetralogy of Fallot (TOF). TOF is a congenital heart anomaly which consists of pulmonary stenosis, ventricular septal defect, dextroposition of the aorta (aorta is on the right side instead of the left) and hypertrophy of the right ventricle. This condition results in a blue baby at birth due to inadequate oxygenation. Surgical correction is emergent. Defects in ZFPM2 are the cause of diaphragmatic hernia 3 (DIH3); a form of congenital diaphragmatic hernia (CDH). CDH refers to a group of congenital defects in the structural integrity of the diaphragm associated with often lethal pulmonary hypoplasia and pulmonary hypertension. Belongs to the FOG (Friend of GATA) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 8q23

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein binding; DNA binding; zinc ion binding; transcription factor binding; transcription corepressor activity

Biological Process: transcription, DNA-dependent; in utero embryonic development; gonadal mesoderm development; embryonic organ development; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; vasculogenesis; negative regulation of fat cell differentiation; negative regulation of transcription, DNA-dependent; blood coagulation; lung development

Disease: Tetralogy Of Fallot; 46,xy Sex Reversal 9; Diaphragmatic Hernia 3

Research Articles on ZFPM2

Similar Products

Product Notes

The ZFPM2 zfpm2 (Catalog #AAA3223128) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZFPM2 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZFPM2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZFPM2 zfpm2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QENISQNPQH EDDHKSPSWI SENPLAANEN VSPGIPSAEE QLSSIAKGVN. It is sometimes possible for the material contained within the vial of "ZFPM2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.