Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Collagen Type IV alpha 3 antibody (MBS839706) used at 1 ug/ml to detect target protein.)

Rabbit Collagen Type IV alpha 3 Polyclonal Antibody | anti-COL4A3 antibody

Collagen Type IV alpha 3 antibody

Reactivity
Reacts with: Human
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Rat.
Applications
Western Blot, Immunoprecipitation
Purity
Affinity purified
Synonyms
Collagen Type IV alpha 3; Polyclonal Antibody; Collagen Type IV alpha 3 antibody; Polyclonal Collagen Type IV alpha 3; Anti-Collagen Type IV alpha 3; CERT; Arresten; CERTL; Canstatin; COL4A3BP; FLJ20597; STARD11; Goodpasture Antigen Binding Protein; GPBP; Collagen Of Basement Membrane Alpha 3 Chain; anti-COL4A3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Reacts with: Human
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Rat.
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Purified antibody supplied as a liquid in PBS, with 0.09% NaN3 and 2% Sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence Length
199
Applicable Applications for anti-COL4A3 antibody
Western Blot (WB), Immunoprecipitation (IP)
Application Notes
WB: 1 ug/ml
Biological Significance
This gene encodes a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen. Goodpasture disease is the result of an autoimmune response directed at this antigen. One isoform of this protein is also involved in ceramide intracellular transport. Two transcripts exist for this gene.
Cross-Reactivity
Human
Immunogen
Collagen Type IV alpha 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICL
Preparation and Storage
4 degree C short term, -20 degree C long term. Avoid repeat freeze-thaws.

Western Blot (WB)

(Collagen Type IV alpha 3 antibody (MBS839706) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Collagen Type IV alpha 3 antibody (MBS839706) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-COL4A3 antibody
Rabbit polyclonal Collagen Type IV alpha 3 antibody
Product Categories/Family for anti-COL4A3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
68 kDa (MW of target protein)
NCBI Official Full Name
collagen type IV alpha 3, partial
NCBI Official Synonym Full Names
collagen, type IV, alpha 3 (Goodpasture antigen)
NCBI Official Symbol
COL4A3
NCBI Protein Information
collagen alpha-3(IV) chain
UniProt Protein Name
Collagen alpha-3(IV) chain
Protein Family
UniProt Gene Name
COL4A3
UniProt Entry Name
CO4A3_HUMAN

NCBI Description

Type IV collagen, the major structural component of basement membranes, is a multimeric protein composed of 3 alpha subunits. These subunits are encoded by 6 different genes, alpha 1 through alpha 6, each of which can form a triple helix structure with 2 other subunits to form type IV collagen. This gene encodes alpha 3. In the Goodpasture syndrome, autoantibodies bind to the collagen molecules in the basement membranes of alveoli and glomeruli. The epitopes that elicit these autoantibodies are localized largely to the non-collagenous C-terminal domain of the protein. A specific kinase phosphorylates amino acids in this same C-terminal region and the expression of this kinase is upregulated during pathogenesis. This gene is also linked to an autosomal recessive form of Alport syndrome. The mutations contributing to this syndrome are also located within the exons that encode this C-terminal region. Like the other members of the type IV collagen gene family, this gene is organized in a head-to-head conformation with another type IV collagen gene so that each gene pair shares a common promoter. [provided by RefSeq, Jun 2010]

Uniprot Description

COL4A3: Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Autoantibodies against the NC1 domain of alpha 3(IV) are found in Goodpasture syndrome, an autoimmune disease of lung and kidney. Defects in COL4A3 are a cause of Alport syndrome autosomal recessive (APSAR). APSAR is characterized by progressive glomerulonephritis, glomerular basement membrane defects, renal failure, sensorineural deafness and specific eye abnormalities (lenticonous and macular flecks). The disorder shows considerable heterogeneity in that families differ in the age of end-stage renal disease and the occurrence of deafness. Defects in COL4A3 are a cause of benign familial hematuria (BFH); also known as thin basement membrane nephropathy. BFH is characterized by persistent hematuria, an electron microscopically detectable thin glomerular basement membrane (GBM) and an autosomal dominant mode of inheritance. Renal function remains normal. In children, differentiation between BFH and AS can be difficult, because both disorders are manifested by persistent hematuria and thin GBM at that age. Defects in COL4A3 are a cause of Alport syndrome autosomal dominant (APSAD). Alport syndrome is characterized by progressive glomerulonephritis, glomerular basement membrane defects, renal failure, sensorineural deafness and specific eye abnormalities (lenticonous and macular flecks). The disorder shows considerable heterogeneity in that families differ in the age of end-stage renal disease and the occurrence of deafness. Belongs to the type IV collagen family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 2q36-q37

Cellular Component: endoplasmic reticulum lumen; collagen type IV; extracellular region; basement membrane

Molecular Function: metalloendopeptidase inhibitor activity; integrin binding; protein binding; extracellular matrix structural constituent; structural molecule activity

Biological Process: caspase activation; axon guidance; extracellular matrix organization and biogenesis; blood circulation; glomerular basement membrane development; collagen catabolic process; extracellular matrix disassembly; negative regulation of cell proliferation; cell proliferation; negative regulation of angiogenesis; cell surface receptor linked signal transduction; sensory perception of sound; cell adhesion

Disease: Hematuria, Benign Familial; Alport Syndrome, Autosomal Dominant; Alport Syndrome, Autosomal Recessive

Research Articles on COL4A3

Similar Products

Product Notes

The COL4A3 col4a3 (Catalog #AAA839706) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Collagen Type IV alpha 3 antibody reacts with Reacts with: Human Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Rat. and may cross-react with other species as described in the data sheet. AAA Biotech's Collagen Type IV alpha 3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunoprecipitation (IP). WB: 1 ug/ml. Researchers should empirically determine the suitability of the COL4A3 col4a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Collagen Type IV alpha 3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.