Western Blot (WB)
(WB Suggested Anti-COLEC12 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Rabbit COLEC12 Polyclonal Antibody | anti-COLEC12 antibody
COLEC12 antibody - middle region
Gene Names
COLEC12; CLP1; NSR2; SRCL; SCARA4
Reactivity
Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
COLEC12; Polyclonal Antibody; COLEC12 antibody - middle region; anti-COLEC12 antibody
Host
Rabbit
Reactivity
Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLGGDGGGCGGGGSGGGGAPRREPVPFPSGSAGPGPRGPRATESGKRMDC
Sequence Length
742
Applicable Applications for anti-COLEC12 antibody
Western Blot (WB)
Homology
Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human COLEC12
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-COLEC12 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-COLEC12 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-COLEC12 antibody
This is a rabbit polyclonal antibody against COLEC12. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: COLEC12 encodes a member of the C-lectin family, proteins that possess collagen-like sequences and carbohydrate recognition domains. This protein is a scavenger receptor, a cell surface glycoprotein that can bind to carbohydrate antigens on microorganisms facilitating their recognition and removal. In addition, these receptors can recognize oxidized phospholipids so they may also participate in removing oxidatively damaged or apoptotic cells.
Target Description: COLEC12 encodes a member of the C-lectin family, proteins that possess collagen-like sequences and carbohydrate recognition domains. This protein is a scavenger receptor, a cell surface glycoprotein that can bind to carbohydrate antigens on microorganisms facilitating their recognition and removal. In addition, these receptors can recognize oxidized phospholipids so they may also participate in removing oxidatively damaged or apoptotic cells.
Product Categories/Family for anti-COLEC12 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82kDa
NCBI Official Full Name
collectin-12
NCBI Official Synonym Full Names
collectin subfamily member 12
NCBI Official Symbol
COLEC12
NCBI Official Synonym Symbols
CLP1; NSR2; SRCL; SCARA4
NCBI Protein Information
collectin-12
UniProt Protein Name
Collectin-12
Protein Family
UniProt Gene Name
COLEC12
UniProt Synonym Gene Names
CLP1; NSR2; SCARA4; SRCL; CL-P1; hCL-P1
UniProt Entry Name
COL12_HUMAN
NCBI Description
This gene encodes a member of the C-lectin family, proteins that possess collagen-like sequences and carbohydrate recognition domains. This protein is a scavenger receptor that displays several functions associated with host defense. It can bind to carbohydrate antigens on microorganisms, facilitating their recognition and removal. It also mediates the recognition, internalization, and degradation of oxidatively modified low density lipoprotein by vascular endothelial cells. [provided by RefSeq, May 2018]
Research Articles on COLEC12
Similar Products
Product Notes
The COLEC12 colec12 (Catalog #AAA3200971) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COLEC12 antibody - middle region reacts with Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's COLEC12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the COLEC12 colec12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLGGDGGGCG GGGSGGGGAP RREPVPFPSG SAGPGPRGPR ATESGKRMDC. It is sometimes possible for the material contained within the vial of "COLEC12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
