Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human COLEC12 Monoclonal Antibody | anti-COLEC12 antibody

COLEC12 (CLP1, NSR2, SCARA4, SRCL, Collectin-12, Collectin Placenta Protein 1, Nurse Cell Scavenger Receptor 2, Scavenger Receptor Class A Member 4, Scavenger Receptor with C-type Lectin)

Gene Names
COLEC12; CLP1; NSR2; SRCL; SCARA4
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
COLEC12; Monoclonal Antibody; COLEC12 (CLP1; NSR2; SCARA4; SRCL; Collectin-12; Collectin Placenta Protein 1; Nurse Cell Scavenger Receptor 2; Scavenger Receptor Class A Member 4; Scavenger Receptor with C-type Lectin); Anti -COLEC12 (CLP1; anti-COLEC12 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A7
Specificity
Recognizes human COLEC12.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
AISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTNLQQDTSVLQGNLQNQMYSHN
Applicable Applications for anti-COLEC12 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in Western Blot and ELISA.
Immunogen
Partial recombinant corresponding to aa101-201 from human COLEC12 (AAH60789) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged COLEC12 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged COLEC12 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-COLEC12 antibody
This gene encodes a member of the C-lectin family, proteins that possess collagen-like sequences and carbohydrate recognition domains. This protein is a scavenger receptor, a cell surface glycoprotein that can bind to carbohydrate antigens on microorganisms facilitating their recognition and removal. In addition, these receptors can recognize oxidized phospholipids so they may also participate in removing oxidatively damaged or apoptotic cells.
Product Categories/Family for anti-COLEC12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
81,515 Da
NCBI Official Full Name
collectin-12
NCBI Official Synonym Full Names
collectin sub-family member 12
NCBI Official Symbol
COLEC12
NCBI Official Synonym Symbols
CLP1; NSR2; SRCL; SCARA4
NCBI Protein Information
collectin-12; hCL-P1; collectin placenta protein 1; nurse cell scavenger receptor 2; scavenger receptor class A, member 4; scavenger receptor with C-type lectin
UniProt Protein Name
Collectin-12
Protein Family
UniProt Gene Name
COLEC12
UniProt Synonym Gene Names
CLP1; NSR2; SCARA4; SRCL; CL-P1; hCL-P1
UniProt Entry Name
COL12_HUMAN

NCBI Description

This gene encodes a member of the C-lectin family, proteins that possess collagen-like sequences and carbohydrate recognition domains. This protein is a scavenger receptor, a cell surface glycoprotein that displays several functions associated with host defense. It can bind to carbohydrate antigens on microorganisms, facilitating their recognition and removal. It also mediates the recognition, internalization, and degradation of oxidatively modified low density lipoprotein by vascular endothelial cells. [provided by RefSeq, Oct 2011]

Uniprot Description

COLEC12: Scavenger receptor that displays several functions associated with host defense. Promotes binding and phagocytosis of Gram-positive, Gram-negative bacteria and yeast. Mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells. Binds to several carbohydrates including Gal-type ligands, D-galactose, L- and D-fucose, GalNAc, T and Tn antigens in a calcium-dependent manner and internalizes specifically GalNAc in nurse-like cells. Binds also to sialyl Lewis X or a trisaccharide and asialo-orosomucoid (ASOR). May also play a role in the clearance of amyloid beta in Alzheimer disease.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 18p11.32

Cellular Component: collagen; plasma membrane; integral to membrane

Molecular Function: metal ion binding; galactose binding; low-density lipoprotein binding; pattern recognition receptor activity; scavenger receptor activity

Biological Process: receptor-mediated endocytosis; innate immune response; carbohydrate mediated signaling; phagocytosis, recognition; defense response; pattern recognition receptor signaling pathway; protein homooligomerization

Research Articles on COLEC12

Similar Products

Product Notes

The COLEC12 colec12 (Catalog #AAA6010950) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The COLEC12 (CLP1, NSR2, SCARA4, SRCL, Collectin-12, Collectin Placenta Protein 1, Nurse Cell Scavenger Receptor 2, Scavenger Receptor Class A Member 4, Scavenger Receptor with C-type Lectin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's COLEC12 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in Western Blot and ELISA. Researchers should empirically determine the suitability of the COLEC12 colec12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AISTNSELST FRSDILDLRQ QLREITEKTS KNKDTLEKLQ ASGDALVDRQ SQLKETLENN SFLITTVNKT LQAYNGYVTN LQQDTSVLQG NLQNQMYSHN. It is sometimes possible for the material contained within the vial of "COLEC12, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.