Western Blot (WB)
(Western Blot analysis of COL23A1 expression in transfected 293T cell line by COL23A1 polyclonal antibody. Lane 1: COL23A1 transfected lysate (30.7kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human COL23A1 Polyclonal Antibody | anti-COL23A1 antibody
COL23A1 (Collagen alpha-1(XXIII) Chain, DKFZp434K0621) (HRP)
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
COL23A1; Polyclonal Antibody; COL23A1 (Collagen alpha-1(XXIII) Chain; DKFZp434K0621) (HRP); anti-COL23A1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human COL23A1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Sequence Length
2938
Applicable Applications for anti-COL23A1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human COL23A1, aa1-309 (AAH42428.1).
Immunogen Sequence
MESRSGIQAGVRCRDLGSLQPPPLALKQFSSLSLPSSWDYRRLPPRCGFLFEVSETTNPPAGTNSRHTLTVKLDGLAKIRTAREAPSECVCPPGPPGRRGKPGRRGDPGPPGPLGLDGKPGLPGPKGEKGAPGDFGPRGDQGQDGAAGPPGPPGPPGARGPPGDTGKDGPRGAQGPAGPKGEPGQDGEMGPKGPPGPKGEPGVPGKKGDDGTPSQPGPPGPKGEPGSMGPRGENGVDGAPGPKGEPGHRGTDGAAGPRGDVRDPGLGSVSSCSQRLASSSKKNGSEPPPGCAGCPRPQGRAGRHSGDRL
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of COL23A1 expression in transfected 293T cell line by COL23A1 polyclonal antibody. Lane 1: COL23A1 transfected lysate (30.7kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of COL23A1 expression in transfected 293T cell line by COL23A1 polyclonal antibody. Lane 1: COL23A1 transfected lysate (30.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-COL23A1 antibody
Collagen XXIII a1 (COL23A1) is an epithelial cell type 2 transmembrane glycoprotein with multiple collagen-like domains in its extracellular region. Intracellular furin-mediated cleavage of the molecule generates a 58kD shed fragment that forms disulfide-linked trimers. An alternately spliced isoform consists of nearly 300aa of the membrane proximal extracellular domain (ECD), flanked by substituted sequences. COL23A1 is upregulated in many transformed cell lines and serves as an indicator for tumor aggressiveness in prostate cancer. Within the ECD, human COL23A1 shares 89% aa sequence identity with mouse and rat COL23A1.
Product Categories/Family for anti-COL23A1 antibody
NCBI and Uniprot Product Information
NCBI Description
COL23A1 is a member of the transmembrane collagens, a subfamily of the nonfibrillar collagens that contain a single pass hydrophobic transmembrane domain (Banyard et al., 2003 [PubMed 12644459]).[supplied by OMIM, Mar 2008]
Research Articles on COL23A1
Similar Products
Product Notes
The COL23A1 (Catalog #AAA6374350) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COL23A1 (Collagen alpha-1(XXIII) Chain, DKFZp434K0621) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's COL23A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the COL23A1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "COL23A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
