Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using COG8 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Rabbit anti-Human COG8 Polyclonal Antibody | anti-COG8 antibody
COG8 Polyclonal Antibody
Gene Names
COG8; DOR1; CDG2H
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
COG8; Polyclonal Antibody; COG8 Polyclonal Antibody; CDG2H; DOR1; anti-COG8 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MNSYMLISAPAILGTSNMPAAVPATQPGTLQPPMVLLDFPPLACFLNNILVAFNDLRLCCPVALAQDVTGALEDALAKVTKIILAFHRAEEAAFSSGEQELFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNLGHVNIGAIQEPLAFILPKRETLFTLDDQALGPELTAPAPEPPAEEPRLEPAGPACPEGGRAETQAEPPSVGP
Sequence Length
612
Applicable Applications for anti-COG8 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human COG8
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Golgi apparatus membrane, Peripheral membrane protein
Positive Samples
Jurkat, A-431
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using COG8 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using COG8 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Related Product Information for anti-COG8 antibody
This gene encodes a protein that is a component of the conserved oligomeric Golgi (COG) complex, a multiprotein complex that plays a structural role in the Golgi apparatus, and is involved in intracellular membrane trafficking and glycoprotein modification. Mutations in this gene cause congenital disorder of glycosylation, type IIh, a disease that is characterized by under-glycosylated serum proteins, and whose symptoms include severe psychomotor retardation, failure to thrive, seizures, and dairy and wheat product intolerance.
Product Categories/Family for anti-COG8 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 68kDa
Observed: 65kDa
Observed: 65kDa
NCBI Official Full Name
conserved oligomeric Golgi complex subunit 8
NCBI Official Synonym Full Names
component of oligomeric golgi complex 8
NCBI Official Symbol
COG8
NCBI Official Synonym Symbols
DOR1; CDG2H
NCBI Protein Information
conserved oligomeric Golgi complex subunit 8
UniProt Protein Name
Conserved oligomeric Golgi complex subunit 8
Protein Family
UniProt Gene Name
COG8
UniProt Synonym Gene Names
COG complex subunit 8
NCBI Description
This gene encodes a protein that is a component of the conserved oligomeric Golgi (COG) complex, a multiprotein complex that plays a structural role in the Golgi apparatus, and is involved in intracellular membrane trafficking and glycoprotein modification. Mutations in this gene cause congenital disorder of glycosylation, type IIh, a disease that is characterized by under-glycosylated serum proteins, and whose symptoms include severe psychomotor retardation, failure to thrive, seizures, and dairy and wheat product intolerance. [provided by RefSeq, Jul 2008]
Uniprot Description
Required for normal Golgi function.
Research Articles on COG8
Similar Products
Product Notes
The COG8 cog8 (Catalog #AAA9134366) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COG8 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's COG8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the COG8 cog8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNSYMLISAP AILGTSNMPA AVPATQPGTL QPPMVLLDFP PLACFLNNIL VAFNDLRLCC PVALAQDVTG ALEDALAKVT KIILAFHRAE EAAFSSGEQE LFVQFCTVFL EDLVPYLNRC LQVLFPPAQI AQTLGIPPTQ LSKYGNLGHV NIGAIQEPLA FILPKRETLF TLDDQALGPE LTAPAPEPPA EEPRLEPAGP ACPEGGRAET QAEPPSVGP. It is sometimes possible for the material contained within the vial of "COG8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
