Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: COG8Sample Tissue: Human ACHN Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human COG8 Polyclonal Antibody | anti-COG8 antibody

COG8 Antibody - N-terminal region

Gene Names
COG8; DOR1; CDG2H
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
COG8; Polyclonal Antibody; COG8 Antibody - N-terminal region; anti-COG8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MATAATIPSVATATAAALGEVEDEGLLASLFRDRFPEAQWRERPDVGRYL
Sequence Length
612
Applicable Applications for anti-COG8 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human COG8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: COG8Sample Tissue: Human ACHN Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: COG8Sample Tissue: Human ACHN Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-COG8 antibody
This gene encodes a protein that is a component of the conserved oligomeric Golgi (COG) complex, a multiprotein complex that plays a structural role in the Golgi apparatus, and is involved in intracellular membrane trafficking and glycoprotein modification. Mutations in this gene cause congenital disorder of glycosylation, type IIh, a disease that is characterized by under-glycosylated serum proteins, and whose symptoms include severe psychomotor retardation, failure to thrive, seizures, and dairy and wheat product intolerance.
Product Categories/Family for anti-COG8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68 kDa
NCBI Official Full Name
conserved oligomeric Golgi complex subunit 8
NCBI Official Synonym Full Names
component of oligomeric golgi complex 8
NCBI Official Symbol
COG8
NCBI Official Synonym Symbols
DOR1; CDG2H
NCBI Protein Information
conserved oligomeric Golgi complex subunit 8
UniProt Protein Name
Conserved oligomeric Golgi complex subunit 8
UniProt Gene Name
COG8
UniProt Synonym Gene Names
COG complex subunit 8
UniProt Entry Name
COG8_HUMAN

NCBI Description

This gene encodes a protein that is a component of the conserved oligomeric Golgi (COG) complex, a multiprotein complex that plays a structural role in the Golgi apparatus, and is involved in intracellular membrane trafficking and glycoprotein modification. Mutations in this gene cause congenital disorder of glycosylation, type IIh, a disease that is characterized by under-glycosylated serum proteins, and whose symptoms include severe psychomotor retardation, failure to thrive, seizures, and dairy and wheat product intolerance. [provided by RefSeq, Jul 2008]

Uniprot Description

COG8: Required for normal Golgi function. Defects in COG8 are the cause of congenital disorder of glycosylation type 2H (CDG2H). CDGs are a family of severe inherited diseases caused by a defect in protein N- glycosylation. They are characterized by under-glycosylated serum proteins. These multisystem disorders present with a wide variety of clinical features, such as disorders of the nervous system development, psychomotor retardation, dysmorphic features, hypotonia, coagulation disorders, and immunodeficiency. The broad spectrum of features reflects the critical role of N-glycoproteins during embryonic development, differentiation, and maintenance of cell functions. Belongs to the COG8 family.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: Golgi membrane; Golgi transport complex; membrane

Molecular Function: protein binding

Biological Process: cellular protein metabolic process; ER to Golgi vesicle-mediated transport; intra-Golgi vesicle-mediated transport; post-translational protein modification; protein amino acid N-linked glycosylation via asparagine; protein transport

Disease: Congenital Disorder Of Glycosylation, Type Iih

Research Articles on COG8

Similar Products

Product Notes

The COG8 cog8 (Catalog #AAA3220899) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COG8 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's COG8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the COG8 cog8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MATAATIPSV ATATAAALGE VEDEGLLASL FRDRFPEAQW RERPDVGRYL. It is sometimes possible for the material contained within the vial of "COG8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.