Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Cog1Sample Type: Mouse Brain lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Cog1 Polyclonal Antibody | anti-COG1 antibody

Cog1 Antibody - C-terminal region

Gene Names
Cog1; Ldlb; mKIAA1381; 6030445I15
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Cog1; Polyclonal Antibody; Cog1 Antibody - C-terminal region; anti-COG1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ENQIKKEGAFPMTQNRALQLLYDLRYLTMVLSSKGEEVKSGRSKADSRME
Sequence Length
980
Applicable Applications for anti-COG1 antibody
Western Blot (WB)
Homology
Dog: 83%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 86%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Cog1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Cog1Sample Type: Mouse Brain lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: Cog1Sample Type: Mouse Brain lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-COG1 antibody
This is a rabbit polyclonal antibody against Cog1. It was validated on Western Blot

Target Description: Cog1 is required for normal Golgi function.
Product Categories/Family for anti-COG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
109kDa
NCBI Official Full Name
conserved oligomeric Golgi complex subunit 1
NCBI Official Synonym Full Names
component of oligomeric golgi complex 1
NCBI Official Symbol
Cog1
NCBI Official Synonym Symbols
Ldlb; mKIAA1381; 6030445I15
NCBI Protein Information
conserved oligomeric Golgi complex subunit 1
UniProt Protein Name
Conserved oligomeric Golgi complex subunit 1
UniProt Gene Name
Cog1
UniProt Synonym Gene Names
Ldlb; COG complex subunit 1
UniProt Entry Name
COG1_MOUSE

Uniprot Description

COG1: Required for normal Golgi function. Defects in COG1 are the cause of congenital disorder of glycosylation type 2G (CDG2G); also known as CDG-II caused by COG1 deficiency. CDGs are a family of severe inherited diseases caused by a defect in glycoprotein biosynthesis. They are characterized by under-glycosylated serum glycoproteins. These multisystem disorders present with a wide variety of clinical features, such as disorders of the nervous system development, psychomotor retardation, dysmorphic features, hypotonia, coagulation disorders and immunodeficiency. The broad spectrum of features reflects the critical role of N-glycoproteins during embryonic development, differentiation, and maintenance of cell functions. Clinical features of CDG2G include failure to thrive, generalized hypotonia, growth retardation and mild psychomotor retardation. CDG2G is biochemically characterized by a defect in O-glycosylation as well as N-glycosylation. Belongs to the COG1 family.

Protein type: Vesicle

Cellular Component: Golgi apparatus; membrane; Golgi transport complex

Biological Process: protein transport; transport

Similar Products

Product Notes

The COG1 cog1 (Catalog #AAA3216512) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cog1 Antibody - C-terminal region reacts with Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Cog1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the COG1 cog1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ENQIKKEGAF PMTQNRALQL LYDLRYLTMV LSSKGEEVKS GRSKADSRME. It is sometimes possible for the material contained within the vial of "Cog1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.