Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CNN2 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateCNN2 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit CNN2 Polyclonal Antibody | anti-CNN2 antibody

CNN2 antibody - N-terminal region

Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CNN2; Polyclonal Antibody; CNN2 antibody - N-terminal region; anti-CNN2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILC
Sequence Length
309
Applicable Applications for anti-CNN2 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CNN2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CNN2 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateCNN2 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (WB Suggested Anti-CNN2 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateCNN2 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-CNN2 antibody
This is a rabbit polyclonal antibody against CNN2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CNN2, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. CNN2 could play a role in smooth muscle contraction and cell adhesion.The protein encoded by this gene, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. The encoded protein could play a role in smooth muscle contraction and cell adhesion. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-CNN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
calponin-2 isoform a
NCBI Official Synonym Full Names
calponin 2
NCBI Official Symbol
CNN2
NCBI Protein Information
calponin-2
UniProt Protein Name
Calponin-2
Protein Family
UniProt Gene Name
CNN2
UniProt Entry Name
CNN2_HUMAN

NCBI Description

The protein encoded by this gene, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. The encoded protein could play a role in smooth muscle contraction and cell adhesion. Several pseudogenes of this gene have been identified, and are present on chromosomes 1, 2, 3, 6, 9, 11, 13, 15, 16, 21 and 22. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2015]

Uniprot Description

calponin 2: Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity. Belongs to the calponin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Actin-binding; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: focal adhesion; cytoskeleton; membrane; stress fiber; intercellular junction

Molecular Function: calmodulin binding; actin binding

Biological Process: regulation of actin filament-based process; negative regulation of phagocytosis; wound healing; actomyosin structure organization and biogenesis; cytoskeleton organization and biogenesis; hemopoiesis; negative regulation of cell migration; regulation of cell proliferation

Research Articles on CNN2

Similar Products

Product Notes

The CNN2 cnn2 (Catalog #AAA3210571) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CNN2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CNN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CNN2 cnn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YGLSAEVKNR LLSKYDPQKE AELRTWIEGL TGLSIGPDFQ KGLKDGTILC. It is sometimes possible for the material contained within the vial of "CNN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.