Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CLEC14ASample Type: Fetal Brain lysatesAntibody Dilution: 0.25ug/ml)

Rabbit anti-Dog, Human CLEC14A Polyclonal Antibody | anti-CLEC14A antibody

CLEC14A Antibody - C-terminal region

Gene Names
CLEC14A; CEG1; EGFR-5; C14orf27
Reactivity
Dog, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CLEC14A; Polyclonal Antibody; CLEC14A Antibody - C-terminal region; anti-CLEC14A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SQPRKESMGPPGLESDPEPAALGSSSAHCTNNGVKVGDCDLRDRAEGALL
Sequence Length
490
Applicable Applications for anti-CLEC14A antibody
Western Blot (WB)
Homology
Dog: 93%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CLEC14A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CLEC14ASample Type: Fetal Brain lysatesAntibody Dilution: 0.25ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CLEC14ASample Type: Fetal Brain lysatesAntibody Dilution: 0.25ug/ml)
Related Product Information for anti-CLEC14A antibody
This is a rabbit polyclonal antibody against CLEC14A. It was validated on Western Blot

Target Description: This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. This family member plays a role in cell-cell adhesion and angiogenesis. It functions in filopodia formation, cell migration and tube formation. Due to its presence at higher levels in tumor endothelium than in normal tissue endothelium, it is considered to be a candidate for tumor vascular targeting.
Product Categories/Family for anti-CLEC14A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
C-type lectin domain family 14 member A
NCBI Official Synonym Full Names
C-type lectin domain containing 14A
NCBI Official Symbol
CLEC14A
NCBI Official Synonym Symbols
CEG1; EGFR-5; C14orf27
NCBI Protein Information
C-type lectin domain family 14 member A
UniProt Protein Name
C-type lectin domain family 14 member A
UniProt Gene Name
CLEC14A
UniProt Synonym Gene Names
C14orf27; EGFR5; EGFR-5
UniProt Entry Name
CLC14_HUMAN

NCBI Description

This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. This family member plays a role in cell-cell adhesion and angiogenesis. It functions in filopodia formation, cell migration and tube formation. Due to its presence at higher levels in tumor endothelium than in normal tissue endothelium, it is considered to be a candidate for tumor vascular targeting. [provided by RefSeq, Jan 2012]

Uniprot Description

CLEC14A:

Protein type: Membrane protein, integral; Protease

Chromosomal Location of Human Ortholog: 14q21.1

Cellular Component: integral to membrane

Molecular Function: carbohydrate binding

Research Articles on CLEC14A

Similar Products

Product Notes

The CLEC14A clec14a (Catalog #AAA3217760) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLEC14A Antibody - C-terminal region reacts with Dog, Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLEC14A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CLEC14A clec14a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SQPRKESMGP PGLESDPEPA ALGSSSAHCT NNGVKVGDCD LRDRAEGALL. It is sometimes possible for the material contained within the vial of "CLEC14A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.