Western Blot (WB)
(Claudin Domain Containing 1 antibody (MBS5302109) used at 1 ug/ml to detect target protein.)
Rabbit Claudin Domain Containing 1 Polyclonal Antibody | anti-CLDND1 antibody
Claudin Domain Containing 1 antibody
Gene Names
CLDND1; C3orf4; GENX-3745
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
Claudin Domain Containing 1; Polyclonal Antibody; Claudin Domain Containing 1 antibody; Polyclonal Claudin Domain Containing 1; Anti-Claudin Domain Containing 1; Claudin Domain Containing -1; CLDND1; C3orf4; GENX-3745; MGC111162; MGC9861; MGC3316; anti-CLDND1 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
Claudin Domain Containing 1 antibody was raised against the middle region of CLDND1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLDND1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
253
Applicable Applications for anti-CLDND1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
CLDND1 belongs to the PMP-22/EMP/MP20 family. The exact function of CLDND1 remains unknown.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
Claudin Domain Containing 1 antibody was raised using the middle region of CLDND1 corresponding to a region with amino acids TLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(Claudin Domain Containing 1 antibody (MBS5302109) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(Claudin Domain Containing 1 antibody (MBS5302109) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-CLDND1 antibody
Rabbit polyclonal Claudin Domain Containing 1 antibody raised against the middle region of CLDND1
Product Categories/Family for anti-CLDND1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
28 kDa (MW of target protein)
NCBI Official Full Name
Claudin domain containing 1
NCBI Official Synonym Full Names
claudin domain containing 1
NCBI Official Symbol
CLDND1
NCBI Official Synonym Symbols
C3orf4; GENX-3745
NCBI Protein Information
claudin domain-containing protein 1
UniProt Protein Name
Claudin domain-containing protein 1
Protein Family
UniProt Gene Name
CLDND1
UniProt Synonym Gene Names
C3orf4
UniProt Entry Name
CLDN1_HUMAN
Uniprot Description
CLDND1: Belongs to the PMP-22/EMP/MP20 family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, multi-pass; Membrane protein, integral
Chromosomal Location of Human Ortholog: 3q12.1
Cellular Component: cell surface; apical plasma membrane; integral to membrane
Research Articles on CLDND1
Similar Products
Product Notes
The CLDND1 cldnd1 (Catalog #AAA5302109) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Claudin Domain Containing 1 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Claudin Domain Containing 1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the CLDND1 cldnd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Claudin Domain Containing 1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
