Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-CITED2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit CITED2 Polyclonal Antibody | anti-CITED2 antibody

CITED2 antibody - N-terminal region

Gene Names
CITED2; ASD8; MRG1; VSD2; MRG-1; P35SRJ
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
CITED2; Polyclonal Antibody; CITED2 antibody - N-terminal region; anti-CITED2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVA
Sequence Length
270
Applicable Applications for anti-CITED2 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CITED2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-CITED2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-CITED2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-CITED2 antibody
This is a rabbit polyclonal antibody against CITED2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CITED2 belongs to the CITED family. It interferes with the binding of transcription factors HIF-1a and STAT2 to p300/CBP.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
cbp/p300-interacting transactivator 2 isoform 1
NCBI Official Synonym Full Names
Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 2
NCBI Official Symbol
CITED2
NCBI Official Synonym Symbols
ASD8; MRG1; VSD2; MRG-1; P35SRJ
NCBI Protein Information
cbp/p300-interacting transactivator 2
UniProt Protein Name
Cbp/p300-interacting transactivator 2
UniProt Gene Name
CITED2
UniProt Synonym Gene Names
MRG1; MRG-1
UniProt Entry Name
CITE2_HUMAN

NCBI Description

The protein encoded by this gene inhibits transactivation of HIF1A-induced genes by competing with binding of hypoxia-inducible factor 1-alpha to p300-CH1. Mutations in this gene are a cause of cardiac septal defects. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012]

Uniprot Description

CITED2: Transcriptional coactivator of the p300/CBP-mediated trancription complex. Acts as a bridge, linking TFAP2 transcription factors and the p300/CBP transcriptional coactivator complex in order to stimulate TFAP2-mediated transcriptional activation. Positively regulates TGF-beta signaling through its association with the SMAD/p300/CBP-mediated transcriptional coactivator complex. Stimulates the peroxisome proliferator- activated receptors PPARA transcriptional activity. Enhances estrogen-dependent transactivation mediated by estrogen receptors. Acts also as a transcriptional corepressor; interferes with the binding of the transcription factors HIF1A or STAT2 and the p300/CBP transcriptional coactivator complex. Participates in sex determination and early gonad development by stimulating transcription activation of SRY. Plays a role in controlling left- right patterning during embryogenesis; potentiates transcriptional activation of NODAL-mediated gene transcription in the left lateral plate mesoderm (LPM). Plays an essential role in differentiation of the adrenal cortex from the adrenogonadal primordium (AGP); stimulates WT1-mediated transcription activation thereby up-regulating the nuclear hormone receptor NR5A1 promoter activity. Associates with chromatin to the PITX2 P1 promoter region. Defects in CITED2 are a cause of ventricular septal defect type 2 (VSD2). VSD2 is a common form of congenital cardiovascular anomaly that may occur alone or in combination with other cardiac malformations. It can affect any portion of the ventricular septum, resulting in abnormal communications between the two lower chambers of the heart. Classification is based on location of the communication, such as perimembranous, inlet, outlet (infundibular), central muscular, marginal muscular, or apical muscular defect. Large defects that go unrepaired may give rise to cardiac enlargement, congestive heart failure, pulmonary hypertension, Eisenmenger's syndrome, delayed fetal brain development, arrhythmias, and even sudden cardiac death. Defects in CITED2 are a cause of atrial septal defect type 8 (ASD8). ASD8 is a congenital heart malformation characterized by incomplete closure of the wall between the atria resulting in blood flow from the left to the right atria. Belongs to the CITED family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; Transcription, coactivator/corepressor; Motility/polarity/chemotaxis; Apoptosis; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 6q23.3

Cellular Component: nuclear chromatin; cytoplasm; nucleus

Molecular Function: histone acetyltransferase binding; protein binding; transcription coactivator activity; LBD domain binding; chromatin binding; transcription corepressor activity; transcription factor activity

Biological Process: spleen development; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; heart development; positive regulation of transforming growth factor beta receptor signaling pathway; positive regulation of cell cycle; negative regulation of transcription from RNA polymerase II promoter; liver development; sex determination; cell proliferation; response to estrogen stimulus; response to hypoxia; positive regulation of cell-cell adhesion; positive regulation of transcription from RNA polymerase II promoter; determination of left/right symmetry; cell differentiation; negative regulation of transcription, DNA-dependent; negative regulation of cell migration; negative regulation of apoptosis

Disease: Atrial Septal Defect 8; Ventricular Septal Defect 2

Research Articles on CITED2

Similar Products

Product Notes

The CITED2 cited2 (Catalog #AAA3202753) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CITED2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CITED2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the CITED2 cited2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HIHYGAGNMN ATSGIRHAMG PGTVNGGHPP SALAPAARFN NSQFMGPPVA. It is sometimes possible for the material contained within the vial of "CITED2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.