Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CHSY1Sample Tissue: Human LN18 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CHSY1 Polyclonal Antibody | anti-CHSY1 antibody

CHSY1 Antibody - middle region

Gene Names
CHSY1; CHSY; CSS1; TPBS; ChSy-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CHSY1; Polyclonal Antibody; CHSY1 Antibody - middle region; anti-CHSY1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FYENYEQNKKGYIRDLHNSKIHQAITLHPNKNPPYQYRLHSYMLSRKISE
Sequence Length
802
Applicable Applications for anti-CHSY1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CHSY1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CHSY1Sample Tissue: Human LN18 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CHSY1Sample Tissue: Human LN18 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CHSY1 antibody
This gene encodes a member of the chondroitin N-acetylgalactosaminyltransferase family. These enzymes possess dual glucuronyltransferase and galactosaminyltransferase activity and play critical roles in the biosynthesis of chondroitin sulfate, a glycosaminoglycan involved in many biological processes including cell proliferation and morphogenesis. Decreased expression of this gene may play a role in colorectal cancer, and mutations in this gene are a cause of temtamy preaxial brachydactyly syndrome.
Product Categories/Family for anti-CHSY1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88 kDa
NCBI Official Full Name
chondroitin sulfate synthase 1
NCBI Official Synonym Full Names
chondroitin sulfate synthase 1
NCBI Official Symbol
CHSY1
NCBI Official Synonym Symbols
CHSY; CSS1; TPBS; ChSy-1
NCBI Protein Information
chondroitin sulfate synthase 1
UniProt Protein Name
Chondroitin sulfate synthase 1
UniProt Gene Name
CHSY1
UniProt Synonym Gene Names
CHSY; CSS1; KIAA0990; ChSy-1
UniProt Entry Name
CHSS1_HUMAN

NCBI Description

This gene encodes a member of the chondroitin N-acetylgalactosaminyltransferase family. These enzymes possess dual glucuronyltransferase and galactosaminyltransferase activity and play critical roles in the biosynthesis of chondroitin sulfate, a glycosaminoglycan involved in many biological processes including cell proliferation and morphogenesis. Decreased expression of this gene may play a role in colorectal cancer, and mutations in this gene are a cause of temtamy preaxial brachydactyly syndrome. [provided by RefSeq, Dec 2011]

Uniprot Description

CHSY1: Has both beta-1,3-glucuronic acid and beta-1,4-N- acetylgalactosamine transferase activity. Transfers glucuronic acid (GlcUA) from UDP-GlcUA and N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of the elongating chondroitin polymer. Involved in the negative control of osteogenesis likely through the modulation of NOTCH signaling. Defects in CHSY1 are the cause of Temtamy preaxial brachydactyly syndrome (TPBS). A syndrome characterized by multiple congenital anomalies, mental retardation, sensorineural deafness, talon cusps of upper central incisors, growth retardation, and bilateral symmetric digital anomalies mainly in the form of preaxial brachydactyly and hyperphalangism. Belongs to the chondroitin N- acetylgalactosaminyltransferase family.

Protein type: EC 2.4.1.175; EC 2.4.1.226; Transferase; Membrane protein, integral; Glycan Metabolism - chondroitin sulfate biosynthesis

Chromosomal Location of Human Ortholog: 15q26.3

Cellular Component: Golgi membrane; membrane; integral to membrane; extracellular region

Molecular Function: N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase activity; metal ion binding; glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase activity

Biological Process: response to nutrient levels; chondroitin sulfate metabolic process; chondroitin sulfate biosynthetic process; glycosaminoglycan metabolic process; carbohydrate metabolic process; sulfation; negative regulation of ossification; positive regulation of smoothened signaling pathway; pathogenesis; chondrocyte development; proximal/distal pattern formation

Disease: Temtamy Preaxial Brachydactyly Syndrome

Research Articles on CHSY1

Similar Products

Product Notes

The CHSY1 chsy1 (Catalog #AAA3222705) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHSY1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHSY1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHSY1 chsy1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FYENYEQNKK GYIRDLHNSK IHQAITLHPN KNPPYQYRLH SYMLSRKISE. It is sometimes possible for the material contained within the vial of "CHSY1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.