Western Blot (WB)
(WB Suggested Anti-Chst11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Rat Kidney)
Rabbit Chst11 Polyclonal Antibody | anti-CHST11 antibody
Chst11 antibody - C-terminal region
Gene Names
Chst11; C4ST1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Chst11; Polyclonal Antibody; Chst11 antibody - C-terminal region; anti-CHST11 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDS
Sequence Length
352
Applicable Applications for anti-CHST11 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Rat
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Chst11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Rat Kidney)
Western Blot (WB)
(WB Suggested Anti-Chst11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Rat Kidney)
Related Product Information for anti-CHST11 antibody
This is a rabbit polyclonal antibody against Chst11. It was validated on Western Blot
Target Description: Chst11 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Chst11 can also sulfate Gal residues in desulfated dermatan sulfate. Chst11 preferentially sulfates in GlcA->GalNAc unit than in IdoA->GalNAc unit. Does not form 4, 6-di-O-sulfated GalNAc when chondroitin sulfate C is used as an acceptor.
Target Description: Chst11 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Chst11 can also sulfate Gal residues in desulfated dermatan sulfate. Chst11 preferentially sulfates in GlcA->GalNAc unit than in IdoA->GalNAc unit. Does not form 4, 6-di-O-sulfated GalNAc when chondroitin sulfate C is used as an acceptor.
Product Categories/Family for anti-CHST11 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
carbohydrate sulfotransferase 11
NCBI Official Synonym Full Names
carbohydrate sulfotransferase 11
NCBI Official Symbol
Chst11
NCBI Official Synonym Symbols
C4ST1
NCBI Protein Information
carbohydrate sulfotransferase 11
UniProt Protein Name
Carbohydrate sulfotransferase 11
Protein Family
UniProt Gene Name
Chst11
UniProt Synonym Gene Names
C4S-1; C4ST-1; C4ST1
UniProt Entry Name
CHSTB_RAT
Similar Products
Product Notes
The CHST11 chst11 (Catalog #AAA3208578) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Chst11 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Chst11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHST11 chst11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FEEFVAYLID PHTQREEPFN EHWQTVYSLC HPCHIHYDLV GKYETLEEDS. It is sometimes possible for the material contained within the vial of "Chst11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
